DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and Txnip

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001009935.1 Gene:Txnip / 56338 MGIID:1889549 Length:397 Species:Mus musculus


Alignment Length:439 Identity:88/439 - (20%)
Similarity:156/439 - (35%) Gaps:111/439 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNCMITFDQNEHGTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQWRIRRHGKAVAIQNPK 67
            |:..:.|:..|. .|.:|:.:.|:|||.:.:..:::.:::...|.|:..|               
Mouse     8 KSFEVVFNDPEK-VYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLW--------------- 56

  Fly    68 KRSKHQYSGREDYIASTTYLMGSEQ---GSN---FNMDAGTYTYTFACPIP-SHCPSSFEGAYGH 125
            .:...|.....||:.....|:..||   |.|   .......|.|.|...:| ....:||:|.||.
Mouse    57 MQGSQQCKQTLDYLRYEDTLLLEEQPTAGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGC 121

  Fly   126 IRYLAKVTFLKPGASNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFCLMHTKPVQLKVTLQ 190
            :.|..|....:|....:.....|.|:.|:|:|....|....|..|.......:....|.:...:.
Mouse   122 VDYWVKAFLDRPSQPTQEAKKNFEVMDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARID 186

  Fly   191 QQGYVPGQFMLIHAHVRNDSSSDCRKLLI---MLHLRATYTADTPSLRTTSEKIMLVKRECGPVA 252
            ::|:..|..:.|||    |..:.|.::::   .:..|.||.|:..: :..::|:..|:..     
Mouse   187 RKGFCEGDDISIHA----DFENTCSRIVVPKAAIVARHTYLANGQT-KVFTQKLSSVRGN----- 241

  Fly   253 HNAQRTYT----ETLRIPATAPT---CEHLSKVVRVSYEVRVVAVMNWLMANPRLIIPVTIGNVP 310
            |....|..    ::||:....|:   |    .:::|.|.               |:|.|::    
Mouse   242 HIISGTCASWRGKSLRVQKIRPSILGC----NILKVEYS---------------LLIYVSV---- 283

  Fly   311 LATAVSGPDFLPTNAFPSGSSLPADLPCTSTRAMELAQMAASGVSNSGYEMA-EDL--------- 365
                            |....:..|||........|:...:|..|.:..||: .||         
Mouse   284 ----------------PGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEMSWIDLNIPDTPEAP 332

  Fly   366 --------EDFELPEDGDDELEAADD--------FVPD---LPPPTYEQ 395
                    ||..|.......|:..||        :.|:   :|||||.:
Mouse   333 PCYMDIIPEDHRLESPTTPLLDDVDDSQDSPIFMYAPEFQFMPPPTYTE 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 35/158 (22%)
Arrestin_C 179..308 CDD:280848 25/138 (18%)
TxnipNP_001009935.1 Arrestin_N 10..153 CDD:304627 35/158 (22%)
Arrestin_C 175..299 CDD:280848 29/172 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm42766
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.