DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and arrdc3

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001016843.1 Gene:arrdc3 / 549597 XenbaseID:XB-GENE-5732341 Length:412 Species:Xenopus tropicalis


Alignment Length:420 Identity:105/420 - (25%)
Similarity:179/420 - (42%) Gaps:59/420 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNCMITFD--QNEH-GTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQW-RIRRHGKAVA- 62
            |:..|:||  ...| ..|.:|..::|:|.:.:....:::.:::...|:|:.:| ..|..|...| 
 Frog     7 KSLTISFDCLNGSHVPVYSSGDAVSGRVNLEVTGEIRVKSLRIHARGHAKVRWTESRNAGSNTAY 71

  Fly    63 IQNPKKRSKHQYSGREDYIASTTYLMG-------SEQGSNFNMDAGTYTYTFACPIPS-HCPSSF 119
            .||        |:...:|.:....|:|       ||:|.. .:.:|.:.|.|:..:|. ...:||
 Frog    72 TQN--------YTEEVEYFSHKDILIGHERDDDNSEEGLT-TIHSGRHEYAFSFELPQIPLATSF 127

  Fly   120 EGAYGHIRYLAKVTFLKPGASNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFC--LMHTKP 182
            ||.:|.:||..|....:|..........|||.:.:|:|  |..|..|.:....:..|  |..:.|
 Frog   128 EGRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHIDIN--TPSLLAPQAGTKEKTLCCWLCTSGP 190

  Fly   183 VQLKVTLQQQGYVPGQFMLIHAHVRNDSSSDCRKLLIMLHLRATYTADTPSLRTTSEKI-MLVKR 246
            :.|...::::||.||:.:.|.|.:.|.||.      :::...|.|...|...:...::: .||..
 Frog   191 ISLSAKIERKGYTPGESIQIFAEIENCSSR------MVVPKAALYQTQTFYAKGKMKEVKQLVAN 249

  Fly   247 ECGPVAHNAQRTYTET-----LRIPATAPTCEHLSKVVRVSYEVRVVAVMNWLMANPRLIIPVTI 306
            ..|....:.:   |||     |:||..:|:....| ::||.|.:.|...:...| :..|.:|:.|
 Frog   250 LRGESLSSGK---TETWNGKLLKIPPISPSIIDCS-IIRVEYSLMVYVDIPGAM-DLFLNLPLVI 309

  Fly   307 GNVPLATAVSGPDFLPTNAFPSGSSLPADLPCTSTRAMELAQMAASGVSNSGYEMAEDL------ 365
            |.:||     .|....|::..|..|:...|..|.....|.....|..|:.   |..::|      
 Frog   310 GTIPL-----HPFGSRTSSVSSQYSINNWLGLTLPERPEAPPSYAEVVTE---EQRQNLMSSNAC 366

  Fly   366 EDFELPEDGDDELEAADDFVPDLPPPTYEQ 395
            ::|||...|  .|.|.......||||.|.:
 Frog   367 DNFELALQG--PLFAYIQEFRFLPPPLYSE 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 40/164 (24%)
Arrestin_C 179..308 CDD:280848 33/134 (25%)
arrdc3NP_001016843.1 Arrestin_N 9..165 CDD:334019 40/164 (24%)
Arrestin_C 187..314 CDD:214976 34/137 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8042
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm9421
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.