DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and txnipb

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001239433.1 Gene:txnipb / 448858 ZFINID:ZDB-GENE-040917-1 Length:378 Species:Danio rerio


Alignment Length:404 Identity:89/404 - (22%)
Similarity:153/404 - (37%) Gaps:75/404 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQWRIRRHGKAVAIQNPKKRSKH-----QYSG 76
            |..|..:.|:|||.:.:..|:..:||              .|...|..|.||...|     :|..
Zfish    23 YSGGDKVAGRVIVEVAELLKVSAVKL--------------FGVGCAKVNYKKGKLHCSEEIEYLK 73

  Fly    77 REDYIASTTYLMGSEQGSNFNMDAGTYTYTFACPIP-SHC-PSSFEGAYGHIRYLAKVTFLKPGA 139
            .|:.:....:....::||........|.:.|...:| |.| .||:||.:|.::|..:....|...
Zfish    74 YEEILHLDHHSTTDDEGSITLRPGNRYEFMFGFELPQSGCLVSSYEGKFGSVQYYVRAVMEKSSQ 138

  Fly   140 SNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFCLMHTKPVQLKVTLQQQGYVPGQFMLIHA 204
            :.......|.|::.:|:|.:..|.....|.:.......:....|.:..::.::||..|:.:.|.|
Zfish   139 TFAECKRYFEVVEPIDVN
TQELMAPVKGSKQKKVTCMFIPDGSVSIVASIGRKGYCEGEDICIDA 203

  Fly   205 HVRNDSSSDC--RKLLIMLHLRATYTADTPSLRTTSEKIMLVKRE-----CGPVAHNAQRTYTET 262
            ...|.||...  :..:|..|:   |.|:..: :...||:..|:..     .|.:...      ..
Zfish   204 QFENTSSRIVIPKAAIIAKHI---YLANGRT-KVFEEKLTSVRGNHIISGMGDIWQG------RV 258

  Fly   263 LRIPATAPT---CEHLSKVVRVSYEVRVVAVMNWLMANPRLI--IPVTIGNVPLATAVSGPDFLP 322
            ||:|...||   |:    ::.|.|.:|:..   .:..:.:||  :|:.||.:|.....|....:.
Zfish   259 LRVPKLKPTILGCD----IIHVDYSLRIYL---HIPGSEKLILELPLVIGTIPYNGMNSRTSSMS 316

  Fly   323 TNAFPSGS--SLPADLPCTSTRAMELAQMAASGVSNSGYEMAED----LEDFELPEDGDDELEAA 381
            :....|.:  |||:..|            :.|.:||   .|...    |:|:    |.||.....
Zfish   317 SQESASSTCVSLPSSPP------------SYSNISN---RMDSSFIPLLDDY----DEDDSPIFM 362

  Fly   382 DDFVPDLPPPTYEQ 395
            ....|..|||.|.:
Zfish   363 QIHHPLPPPPLYTE 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 34/146 (23%)
Arrestin_C 179..308 CDD:280848 30/140 (21%)
txnipbNP_001239433.1 Arrestin_N 11..156 CDD:304627 34/146 (23%)
Arrestin_C 179..305 CDD:214976 31/142 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.