DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and CG2641

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_649737.1 Gene:CG2641 / 40921 FlyBaseID:FBgn0037518 Length:429 Species:Drosophila melanogaster


Alignment Length:453 Identity:112/453 - (24%)
Similarity:177/453 - (39%) Gaps:77/453 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKNCMITFDQNEHGTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQW---RIRRHGKAVA 62
            |..:|....|:.| ..|::|:.:.|:.|:.....|.:..:.:...|.|:.:|   |.|..|    
  Fly     1 MPSSCSFELDRRE-PIYYSGETVNGRAILTTTSEKSVNEVYILFEGEAKVRWDERRTRTRG---- 60

  Fly    63 IQNPKKRSKH---QYSGREDYIASTTYLMGSEQGSNFNMDAGTYTYTFACPIPSHCPSSFEGAYG 124
                 .:::|   .:.|::.|:.:.|.:.||.     |:..||:||.|..|:|..||||....||
  Fly    61 -----GKTEHYTEYFRGKQQYLYTRTSVFGSG-----NLPPGTHTYNFCIPLPLECPSSVVAQYG 115

  Fly   125 HIRYLAKVTFLKPGASNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFCL--MHTKPVQLKV 187
            .|.|...|...:....|.......||::..:||...::|. |...|.::|||.  ..:.||...:
  Fly   116 KIFYEVSVVIDRQWRFNNVFKQPLTVIQTYNLNMSPQLLM-PLVREDIKHFCCWPCSSGPVLSTL 179

  Fly   188 TLQQQGYVPGQFMLIHAHVRNDSSS-DCRKLLIMLHLRATYTADTPSLRTTSEKIMLVKRECGP- 250
            |:...||.|||.:.....:.|.||. |...:.:.|.....:.|.||. ..|.||...:.:.|.. 
  Fly   180 TIPFGGYAPGQKIRFTLEIDNQSSGYDLNGIELKLKQIYKFQAQTPH-HKTREKEHSLNKSCQQE 243

  Fly   251 -VAHNAQRTYTETLRIPATAPTCEHLSKVVRVSYEVRVVAVMNWLMANPRLIIPVTIGNVPLATA 314
             |...:::....||.|||..|: .....::.|||:|.:.........:....:|:.||.:||..:
  Fly   244 RVLRLSKKKIEGTLAIPAVPPS-SRTEGIISVSYQVILTISTGDCHVDSDFEVPIVIGTIPLIQS 307

  Fly   315 VSGPDFLPTNAFPSGSSLPADLPCTSTRAMELAQMAASGVSNSGYEMAEDLEDFELPEDGDDELE 379
            ...|                         ...||.                    :||..|....
  Fly   308 AENP-------------------------ASAAQW--------------------IPETPDTPAG 327

  Fly   380 AADDFVPD---LPPPTYEQAMFMTTDIADTDANTVSEASRFTPRYPVFDVDTFQSPPPNPPQK 439
            ||.|..|.   ..|||:|:|........|.|.:..:....|.||||::......|.||.||::
  Fly   328 AAADLPPSYDKCKPPTFEEATNFGERFIDIDQDEHNRTDDFIPRYPMYTNFAMPSAPPQPPEE 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 40/157 (25%)
Arrestin_C 179..308 CDD:280848 33/131 (25%)
CG2641NP_649737.1 Arrestin_N 5..148 CDD:278754 40/157 (25%)
Arrestin_C 171..301 CDD:280848 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464077
Domainoid 1 1.000 63 1.000 Domainoid score I10233
eggNOG 1 0.900 - - E1_KOG3780
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I2088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110793at6960
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - otm24709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
109.900

Return to query results.
Submit another query.