DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and ARRB2

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_011522160.1 Gene:ARRB2 / 409 HGNCID:712 Length:440 Species:Homo sapiens


Alignment Length:472 Identity:90/472 - (19%)
Similarity:156/472 - (33%) Gaps:179/472 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GYAQAQWRIRRHGK--------AVAIQNP-----KKRSKH----QYSGREDYI------------ 81
            |..::|.|.:|.|.        ..||:..     ||.|.:    .|.|:.|::            
Human     8 GLGRSQTRAQRRGSGGRTPGSLGTAIRGRTRRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGV 72

  Fly    82 ----------------ASTTYLMGSEQ----GSNFNMDAGTYTYTFACPIPS--HCPSSFE---- 120
                            .:..:..|.|.    |.:|..|....||....|:|:  ..|:..:    
Human    73 VLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLL 137

  Fly   121 ---GAYGHIRYL-------AKVTFLKPGA--SNRTHNVGFTVLKLLDLNQETK---------MLR 164
               |.:.|..:.       ..|| |:||.  :.:...|.|.:......:.|.|         ::|
Human   138 RKLGQHAHPFFFTIPQNLPCSVT-LQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIR 201

  Fly   165 E----------PASNEAVEHFCLMHTKPVQLKVTLQQQGYVPGQFMLIHAHVRNDSSSDCRKLLI 219
            :          ..|.|...|| ||..:.:.|:.:|.::.|..|:.:.::.||.|:|:...:|:.:
Human   202 KVQFAPEKPGPQPSAETTRHF-LMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKV 265

  Fly   220 MLHLRA-------------------------------TYTADTPSLRTTSEKIMLVKRECGPVAH 253
            .:...|                               .||. ||.|....||..|...  |.:.|
Human   266 SVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTI-TPLLSDNREKRGLALD--GKLKH 327

  Fly   254 NAQRTYTETLRIPATAPTCEHLSKVV---RVSYEVRVVAVMN----------WLMANPRLIIPVT 305
                   |...:.::....|..:|.|   .|||.|:|..|::          :::.:|:     .
Human   328 -------EDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPK-----P 380

  Fly   306 IGNVPLATAVSGPDFLPTNAFPSGSSLPADLPCTSTRAMELAQMAASGVSNSGYEMAEDL--EDF 368
            ..::||..        |.:|.|. :.:|.|     |..:|.         ::.|...:|:  |||
Human   381 HDHIPLPR--------PQSAAPE-TDVPVD-----TNLIEF---------DTNYATDDDIVFEDF 422

  Fly   369 E-------LPEDGDDEL 378
            .       ..:|.||:|
Human   423 ARLRLKGMKDDDYDDQL 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 32/177 (18%)
Arrestin_C 179..308 CDD:280848 31/172 (18%)
ARRB2XP_011522160.1 Arrestin_N 50..206 CDD:278754 25/156 (16%)
Arrestin_C 225..380 CDD:214976 31/169 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.