DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and Arrdc1

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_038961502.1 Gene:Arrdc1 / 366001 RGDID:1309961 Length:466 Species:Rattus norvegicus


Alignment Length:389 Identity:85/389 - (21%)
Similarity:145/389 - (37%) Gaps:103/389 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQWRIRRHGKAVAIQNPKKRSKHQYSGREDYI 81
            |..|:.:.|.|.:.|......|.|::...|             :..:.|  |.:...:...|.|.
  Rat    18 YSPGEPLAGAVHLRLGAPLPFRAIRVTCMG-------------SCGVSN--KANDGAWVVEESYF 67

  Fly    82 ASTTYLMGSEQGSNFNMDAGTYTYTFACPIPSHCPSSFEGAYGHIRYLAKVTFLKPGASNRTH-- 144
            .|:..|  :::||   :..|.:.:.|...:|:..|:||||.:|.|.:..:.:...|..| :.|  
  Rat    68 NSSLSL--ADKGS---LPPGEHNFPFQFLLPATAPTSFEGPFGKIVHQVRASIDTPRFS-KDHKC 126

  Fly   145 NVGFTVLKLLDLNQETKMLREP--ASNEAVEHFCLMHTKPVQLKVTLQQQGYVPGQFMLIHAHVR 207
            ::.|.:|..|:|| ....:.:|  ||......:.|:.|..|.|..:...:|||.||.:.:.|.:.
  Rat   127 SLVFYILSPLNLN
-SIPDIEQPNVASTTKKFSYKLVKTGSVVLTASTDLRGYVVGQVLRLQADIE 190

  Fly   208 NDSSSDCRKLLI-MLHLRATYTADT---PSLRTTSEKIMLVKRECGP-----------VAHNAQR 257
            |.|..|...::. :|.:||.:..:.   |..|         :..|.|           |::.|:|
  Rat   191 NQSGKDTSPVVASLLQVRAIWFPEPVPFPWDR---------RGGCQPAQTHSPVFPQKVSYKAKR 246

  Fly   258 ----------------------TYTETLRIPA----TAPTCE--HLSKVVRVSYEVRVVAVMNWL 294
                                  .:.|.:.:||    ..|.|.  |:...::||.:.....|    
  Rat   247 WIYDVRTIAEVEGTGVKAWRHAQWQEQILVPALPQSALPGCSLIHIDYYLQVSMKAPEATV---- 307

  Fly   295 MANPRLIIPVTIGNV-----PLATAVSGPDFLPTNAFPSGSSLPADLPCTSTRAMELAQMAASG 353
                  .:|:.:||:     ||:.. .||...|....|...|.|         ..|.|:..|||
  Rat   308 ------TLPLFVGNIAVNQTPLSPC-PGPGSSPGLLSPVVPSAP---------PQEEAEAVASG 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 32/141 (23%)
Arrestin_C 179..308 CDD:280848 32/171 (19%)
Arrdc1XP_038961502.1 Arrestin_N 7..139 CDD:419887 32/141 (23%)
Arrestin_C 162..316 CDD:214976 33/172 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.