DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and Arrdc3

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001007798.1 Gene:Arrdc3 / 309945 RGDID:1359478 Length:414 Species:Rattus norvegicus


Alignment Length:487 Identity:107/487 - (21%)
Similarity:190/487 - (39%) Gaps:115/487 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNCMITFD---QNEHGTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQW-RIRRHGKAVA- 62
            |:..|:||   .:....|.:|..::|:|.:.:....:::.:|:...|:|:.:| ..|..|...| 
  Rat     7 KSLTISFDCLNDSNVPVYSSGDTVSGRVNLEVTGEIRVKSLKIHARGHAKVRWTESRNAGSNTAY 71

  Fly    63 IQNPKKRSKHQYSGREDYIASTTYLMGSEQGSN------FNMDAGTYTYTFACPIP-SHCPSSFE 120
            .||        |:...:|......|:|.|:..:      ..:.:|.:.|.|:..:| :...:|||
  Rat    72 TQN--------YTEEVEYFNHKDILIGHERDDDNCEEGFSTIHSGRHEYAFSFELPQTPLATSFE 128

  Fly   121 GAYGHIRYLAKVTFLKPGASNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFC--LMHTKPV 183
            |.:|.:||..|....:|..........|||.:.:|:|  |..|..|.:....:..|  ...:.|:
  Rat   129 GRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHIDIN--TPSLLSPQAGTKEKTLCCWFCTSGPI 191

  Fly   184 QLKVTLQQQGYVPGQFMLIHAHVRNDSSSDCRKLLIMLHLRATYTADTPSLRTTSEKIMLVKREC 248
            .|...::::||.||:.:.|.|.:.|.||........:...:|.|...  .::...:.:..::.| 
  Rat   192 SLSAKIERKGYTPGESIQIFAEIENCSSRMVVPKAAIYQTQAFYAKG--KMKEVKQLVANLRGE- 253

  Fly   249 GPVAHNAQRTYT---ETLRIPATAPTCEHLSKVVRVSYE----VRVVAVMNWLMANPRLIIPVTI 306
               :.::.:|.|   :.|:||..:|:....| ::||.|.    |.:...|:.|::     :|:.|
  Rat   254 ---SLSSGKTETWDGKLLKIPPVSPSILDCS-IIRVEYSLMVYVDIPGAMDLLLS-----LPLVI 309

  Fly   307 GNVPL------ATAVSGPDFLPTNAFPSGSSLP---------ADLPCTSTRAMELAQMAASGVSN 356
            |.:||      .::||....:..|..  |.|||         |::.....|...||.::|     
  Rat   310 GTIPLHPFGSRTSSVSSQCSMNMNWL--GLSLPERPEAPPSYAEVVTEEQRRNNLAPVSA----- 367

  Fly   357 SGYEMAEDLEDFELPEDGDDELEAADDFVPDLPPPTYEQAMFMTTDIADTDANTVSEASRFTPRY 421
                    .:|||....|  .|.|.......||||.|.                           
  Rat   368 --------CDDFERALQG--PLFAYIQEFRFLPPPLYS--------------------------- 395

  Fly   422 PVFDVDTFQSPPPNPPQKKRRRRRRRPADPGQ 453
               ::|      |||.|..    ..||:.|.:
  Rat   396 ---EID------PNPDQSS----EDRPSCPSR 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 38/163 (23%)
Arrestin_C 179..308 CDD:280848 29/135 (21%)
Arrdc3NP_001007798.1 Arrestin_N 22..165 CDD:395268 35/150 (23%)
Arrestin_C 187..314 CDD:214976 30/138 (22%)
PPxY motif 1. /evidence=ECO:0000305 346..349 0/2 (0%)
PPxY motif 2. /evidence=ECO:0000305 391..394 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..414 9/60 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm12328
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.