DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and SPAC31A2.12

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_592924.1 Gene:SPAC31A2.12 / 2542940 PomBaseID:SPAC31A2.12 Length:596 Species:Schizosaccharomyces pombe


Alignment Length:481 Identity:80/481 - (16%)
Similarity:169/481 - (35%) Gaps:130/481 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ITGKVIVNLNKTKKLRGIKLQISGYAQAQWRIRRHGKAVAIQNPKKRSKHQYSGREDYIASTTYL 87
            ::|.|::.||:...::.|.|::.|..:..|         :..:|..|...:::.:|..:....::
pombe    39 LSGSVVLCLNEAISVKAISLKLVGKCRISW---------SEPSPTVRGGQRHNKQEYVVYEKNWI 94

  Fly    88 MGSEQGSNFNMDAGTYTYTFACPIPSHCPSSFEGAYG-HIRYLAKVTFLKPGASNRTHNVGFTVL 151
            .....|:|..:.||.|.|.|...:|.....|.||... ::.|..|.:..:.|.:::       ::
pombe    95 FVPYTGANRTLRAGNYEYPFHVMLPGDIAESVEGLQSCYVVYRLKASIDRTGLASK-------MV 152

  Fly   152 KLLDLNQETKMLRE-PASNEAVEH---FCLMHTKP--VQLKVTLQQQGYVPGQFMLIH------- 203
            |    .:..:::|. ||  :|:|:   ..:.:|.|  ::..:::..:.|..|.::.||       
pombe   153 K----KKHIRLIRALPA--DAIEYTQTISVDNTWPNKIEYTISVPTKAYAIGSYIPIHFVLVPLL 211

  Fly   204 AHVRNDSSSDCRKLLIMLHLRATYT---ADTPSLRTTSEKIMLVKRECGPVAHNAQRTYTETLRI 265
            ..:.....|...|..|.||:...|.   |....:||...   |...|....:.:.:  .|:.|.:
pombe   212 KRLTIGKISITLKEYITLHVAHGYNGLPASKDEVRTVRS---LQTEELEEFSDHYE--LTKNLEL 271

  Fly   266 PATAPTCEHLSKVVRVSYEVRVVAVMNWLMANP-------RLIIPVTIGNVPLATAVSGPDFLPT 323
            |::...|  |........::|.....:..:.||       |..:||.:             .:|.
pombe   272 PSSLVEC--LQDCDLDGIKIRHKLKFSVSLRNPDGHISELRAALPVVL-------------MIPP 321

  Fly   324 NAFPSGSSLPADLPCTSTRAMELAQMAASGVSNSGYEMAEDLEDFELPEDGDDELEAADDFVPDL 388
            ..|...:.:.:                          :.|:.|.|                  :.
pombe   322 QLFGDRAEVES--------------------------LRENFESF------------------NQ 342

  Fly   389 PPPTYEQAMF--MTTDIADTDANTVSEASRFTPRYPVFDVDTFQSPPPNPPQKKRRRR------- 444
            |.|:|:.:|:  :...::.::.:|...:...|||       ...|..|.....:..||       
pombe   343 PLPSYQNSMYDRLYDGLSYSNLDTPLPSGATTPR-------RRDSMEPTYASNEAHRRQLIAGLT 400

  Fly   445 ----RRRPADPGQSKQQPEKQPVESP 466
                :::|.....::..|...|.:.|
pombe   401 ELALQQQPQGRSPNEHSPSNHPEDFP 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 26/134 (19%)
Arrestin_C 179..308 CDD:280848 28/147 (19%)
SPAC31A2.12NP_592924.1 Arrestin_N 38..144 CDD:304627 24/113 (21%)
Arrestin_C 180..321 CDD:214976 27/160 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I3293
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.