DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and SPAC1F12.05

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_594331.1 Gene:SPAC1F12.05 / 2542260 PomBaseID:SPAC1F12.05 Length:377 Species:Schizosaccharomyces pombe


Alignment Length:371 Identity:72/371 - (19%)
Similarity:107/371 - (28%) Gaps:127/371 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 GTYTYTFACPIPSHCPSSFEGAYGHIRYLAKVTFLKPGASNRTHNVGFTVLKLLDLNQE--TKML 163
            ||:|:.|...||.|.|.:....:.::.|:.|.....|...:........:.:.:..|.:  .:.|
pombe   104 GTHTWPFTFIIPGHFPQTTNSPFINVTYILKTRVKIPSQPDFVFEYPLNLKRSIVTNADKIAQRL 168

  Fly   164 REPASNEAVEHFCLMHTKPVQLKVTLQQQGYVPGQFMLIHAHVRNDSSSDCRKLLIMLHLRATYT 228
            ..|.|..|     |:...||     :.....||.:|.|......| |....|...|...:.....
pombe   169 FPPTSLIA-----LLELPPV-----IHPLSCVPVEFQLTGVKPEN-SKVGWRLTKISWRIEEQIK 222

  Fly   229 ADTPSLRT-TSEKIMLVKRECGPVAHNAQRTYTETLRIPATAPTCEHLSKVVRVSYEVRVVAVMN 292
            |......| |..|...:.:|...:.:|                  ||.|               .
pombe   223 AQINGCSTHTGTKKPYIFKETRLLGNN------------------EHKS---------------G 254

  Fly   293 WLMANPRLIIPVTIGNVPLATAVSGPDF-------------LPT------NAFPSGSS-----LP 333
            |.....|:|..:.|....|:..:....|             |.|      |:.|..|:     :.
pombe   255 WKEDGDRIIFEIPISTSLLSKPICDVSFDGQFSLYIAHQLILETIVVEVMNSHPINSNARILRMK 319

  Fly   334 ADLPCTSTRAMELAQMAASGVSNSGYEMAEDLEDFELPEDGDDELEAADDFV-PDLPPPTYEQ-A 396
            .:||        |.:....|||                  .|:|.....:.| |.  ||.||| |
pombe   320 VNLP--------LTERGGLGVS------------------WDEECPPMFNSVGPS--PPAYEQVA 356

  Fly   397 MFMTTDIADTDANTVSEASRFTPRYPVFDVDTFQSPPPNPPQKKRR 442
            ....|||                  |:        |||:.|...:|
pombe   357 RSSPTDI------------------PL--------PPPSCPTNVQR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 11/55 (20%)
Arrestin_C 179..308 CDD:280848 23/129 (18%)
SPAC1F12.05NP_594331.1 LDB19 63..231 CDD:193475 28/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.