DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and rnh-1.2

DIOPT Version :10

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_496121.2 Gene:rnh-1.2 / 191471 WormBaseID:WBGene00014163 Length:192 Species:Caenorhabditis elegans


Alignment Length:39 Identity:13/39 - (33%)
Similarity:17/39 - (43%) Gaps:6/39 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 VRNDSSSDCRKLLIMLHLRATYTADTPSL------RTTS 238
            ||...|..|.:.|..:.|:.|.|..|.|:      ||.|
 Worm    64 VRCWDSFKCNQKLEFVRLKNTITPTTSSILIPCTRRTVS 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:425619
Arrestin_C 180..311 CDD:214976 13/39 (33%)
rnh-1.2NP_496121.2 RNase_H_like 8..167 CDD:449355 13/39 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.