DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and arrd-8

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_496568.1 Gene:arrd-8 / 189457 WormBaseID:WBGene00012467 Length:364 Species:Caenorhabditis elegans


Alignment Length:418 Identity:85/418 - (20%)
Similarity:154/418 - (36%) Gaps:94/418 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MITFDQNEHGTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQW-------RIRRHGKAVAI 63
            :|.|| :....|..||.:.||:.:..........:|:.|.|..:..|       |..|||:..  
 Worm     7 LIEFD-HPAAVYSPGQNVAGKLTIRNRNALNALALKICIHGDIETLWRKFENKGRYDRHGRWY-- 68

  Fly    64 QNPKKRSKH-QYSGREDYIASTTYLMGSEQGSNFNMDAGTYTYTFACPIPSHCPSSFEGAYGHIR 127
                :.|:| .|:.:.:.:........|.:.:|..:..|...:.|...:|::.|.||||.:|::|
 Worm    69 ----RSSEHINYTSKINVLEGIAQPWSSIENANNKIPGGVNIFPFLFQLPANLPPSFEGTHGNVR 129

  Fly   128 YLAKVTFLKPGASNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFCLMHTKPVQLKVTLQQQ 192
            |...|...:|...|......|:|:.::|||...|.: .|....:.:|..|...|.|::|:::.:.
 Worm   130 YSVHVELDRPWRMNVEAKRVFSVIPVIDLN
SIPKTI-NPMIVSSCKHSGLFSNKEVKVKISIPKS 193

  Fly   193 GYVPGQFMLIHAHVRNDSSSDCRKLLIMLHLRATYTA-----------------DTPSLRTTSEK 240
            ||:||:.:.:.|.::|.:......:...|.....|.|                 :..:.:||..|
 Worm   194 GYIPGETIQVSALIQNHTKKPIYSIKAKLEQHVHYQAQQENSHLFPEEHCHKHCEHKTAQTTMSK 258

  Fly   241 IMLVKRECG-PVAHNAQRTYTETLRIPATAP---TCEHLSKVVRVSYEVRVVAVMNWLMANPRLI 301
               |::.|. ....|:|      :.:|...|   .....:.::.|.|.:.|....|..:   |..
 Worm   259 ---VEKSCHVEFCSNSQ------INVPLVLPNQLVPSFRTGIIEVDYCIIVDIGENKKL---RCE 311

  Fly   302 IPVTIGNVPLATAVSGPDFLPTNAFPSGSSLPADLPCTSTRAMELAQMAASGVSNSGYEMAEDLE 366
            :|:|:|.:|:........:..|.|.|.                                    .|
 Worm   312 LPITVGTIPIGVFTRPIAYSITEAPPK------------------------------------YE 340

  Fly   367 DFELPEDGDDELEAADDFVPDLPPPTYE 394
            :|.         :..:|.....|||.||
 Worm   341 NFS---------QIVEDSQASAPPPEYE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 38/158 (24%)
Arrestin_C 179..308 CDD:280848 28/149 (19%)
arrd-8NP_496568.1 Arrestin_N 6..159 CDD:334019 38/158 (24%)
Arrestin_C 180..320 CDD:214976 29/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164590
Domainoid 1 1.000 95 1.000 Domainoid score I4648
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119234
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm4733
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.