DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and ARRK

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_317960.1 Gene:ARRK / 1278336 VectorBaseID:AGAP011360 Length:431 Species:Anopheles gambiae


Alignment Length:463 Identity:87/463 - (18%)
Similarity:159/463 - (34%) Gaps:136/463 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKNCMITF-----DQNEHGTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQWRIRRHGKAV 61
            |.|..||.     |..:|.|:.  ..|.|.|:::.:..|:.:     :.|:..|.:|.       
Mosquito    13 SSNGKITVYLGKRDFVDHITHV--DPIDGVVLIDPDYVKERK-----VFGHVLAAFRY------- 63

  Fly    62 AIQNPKKRSKHQYSGREDY-IASTTY----LMGSEQ--------------GSNFNMDAGTYTYTF 107
                          ||||. :...|:    .:.|||              ........|...|.|
Mosquito    64 --------------GREDLDVLGLTFRKDLYLASEQIYPPLETDRPLTRLQERLIRKLGANAYPF 114

  Fly   108 ACPIPSHCPSSFE-----GAYGH---IRYLAKVTFLKPGASNRTHNVGFTVLKLLDLNQETKMLR 164
            ...:|.|||:|..     |..|.   :.|..| .|:.....::.|......|.:..:......|.
Mosquito   115 YFEVPPHCPASVSLQPAPGDTGKPCGVDYELK-AFVGESQEDKPHKRNSVRLAIRKIMYAPSKLG 178

  Fly   165 EPASNEAVEHFCLMHTKPVQLKVTLQQQGYVPGQFMLIHAHVRNDSSSDCRKLLIMLH------- 222
            |..|.|..:.:.|...| :.|:.:|.::.|..|:.:.::.|:.|:||...:|:.:.:.       
Mosquito   179 EQPSIEVSKEYILKPNK-IHLEASLDKELYHHGESLSVNVHIANNSSKTVKKIKVSVRQFADICL 242

  Fly   223 --------------------------LRATYTADTPSLRTTSEKIMLVKRECGPVAHNAQRTYTE 261
                                      |...:|. ||.|....:|..|...  |.:.|......:.
Mosquito   243 FSTAQYKCTVAEVESEDGCQVAPGFTLSKVFTL-TPLLANNKDKWGLALD--GQLKHEDTNLASS 304

  Fly   262 TLRIPATAPTCEHLSKVVRVSYEVRV-----------VAVMNWLMANPRLIIP----VTIGNVPL 311
            ||  .|.....|:|..:|:  |:|:|           ||.:.:::.:|:   |    ..||:...
Mosquito   305 TL--IADPSQRENLGIIVQ--YKVKVKLCITPLGGDLVAELPFILMHPK---PDDDEPVIGDRSP 362

  Fly   312 ATAVSGPDFLPTNAFPSGSSLPADLPCTSTRAMELAQMAASGVSNSGYEMAEDLEDFELPEDGDD 376
            ...|:..|  ..:::.:|.              |:...:.:|.:::..|...:|...:..::|.|
Mosquito   363 GRTVNSAD--RKHSYQAGH--------------EMGSHSNNGDAHASKEDGPNLIQLDGDDNGPD 411

  Fly   377 ELEAADDF 384
            :....:||
Mosquito   412 DDIIFEDF 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 35/183 (19%)
Arrestin_C 179..308 CDD:280848 33/176 (19%)
ARRKXP_317960.1 Arrestin_N 18..173 CDD:278754 35/183 (19%)
Arrestin_C 192..350 CDD:214976 31/168 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.