DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and AgaP_AGAP002691

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_312231.1 Gene:AgaP_AGAP002691 / 1273270 VectorBaseID:AGAP002691 Length:341 Species:Anopheles gambiae


Alignment Length:354 Identity:96/354 - (27%)
Similarity:157/354 - (44%) Gaps:52/354 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MITFDQNEHGTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQWRIRRHGKAVAIQNPKKRS 70
            :|.|| |....||.||.::|:|::.|.....:.|:...:.|....:.|..||.::.         
Mosquito     9 LILFD-NTSLLYFPGQFLSGRVLLELQDDTPVLGLHFHVVGECVVRVRSTRHERSY--------- 63

  Fly    71 KHQYSGREDYIASTTYLMG--SEQGSNFNMDAGTYTYTFACPIPSHCPSSFEGAYGHIRYLAKVT 133
                 .:|:||.....|:|  ..||... :..|.:::.|...:|...||:|.|.||.::|..|..
Mosquito    64 -----DKENYIDFRMRLLGDSDNQGPTI-LSPGIHSFPFKLGLPVDLPSTFLGRYGWVQYFCKAG 122

  Fly   134 FLKP-GASNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEH---FCLMHTKPVQLKVTLQQQGY 194
            ..:| |..::.|.| |.|:..:|||.|...|.:|.... :||   ...:....|:.|:.|.:.||
Mosquito   123 LREPSGLIHKNHQV-FIVMNPIDLN
LEQPYLADPFKCN-IEHNLGMACVGGGIVKCKIILDRGGY 185

  Fly   195 VPGQFMLIHAHVRNDSSSDCRKLLIMLHLRATYTADTPSLR-TTSEKIMLV-KRECGPVAHNAQR 257
            |||:.::|.|.|.|.||         :.:::|..|.|.::: ...:|:|.. |||...:|....|
Mosquito   186 VPGESIMITATVTNASS---------VTIKSTKAALTETIQYFARDKVMQTEKRELAVIARGKIR 241

  Fly   258 T------YTETLRIPATAPTCEHLSKVVRVSYEVRVVAVMNWLMANPRLIIPVTIGNVPLATAVS 316
            .      ..|:|.:|...||......::|:.|:|..:.....|....:|.:|:|:|..|..|| .
Mosquito   242 AGHRDEWQNESLYVPPLPPTNLRGCHLIRIQYDVCFLIEPKSLEKQIKLQLPITLGTYPFKTA-D 305

  Fly   317 GPD--------FLPTNAFPSGSSLPADLP 337
            |.|        :.|...:|  |:||...|
Mosquito   306 GDDTNEWAETIYKPETHYP--STLPIFRP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 41/153 (27%)
Arrestin_C 179..308 CDD:280848 36/136 (26%)
AgaP_AGAP002691XP_312231.1 Arrestin_N 8..146 CDD:419887 41/153 (27%)
Arrestin_C 172..301 CDD:397050 37/137 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D137165at6656
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.