DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and VPS26C

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_006043.1 Gene:VPS26C / 10311 HGNCID:3044 Length:297 Species:Homo sapiens


Alignment Length:345 Identity:64/345 - (18%)
Similarity:118/345 - (34%) Gaps:103/345 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQWRIRRHGKAVAIQNPKKRSKHQYSGREDYI 81
            |..|:|::|.|:::...:.:.:|:.|.:.|....|...:..|...|..|..|..:        .|
Human    16 YHAGEVLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFEAFYNSVKPIQ--------II 72

  Fly    82 ASTTYLMGSEQGSNFNMDAGTYTYTFACPIPSHCP------SSFEGAYGHIRYLAKVTFLKPGAS 140
            .||..::  :.|   ...:|.....|..|:  |..      .::.|.:.:|:|..:....:.   
Human    73 NSTIEMV--KPG---KFPSGKTEIPFEFPL--HLKGNKVLYETYHGVFVNIQYTLRCDMKRS--- 127

  Fly   141 NRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFCLMHTKPVQLKVT------LQQQGYVPGQF 199
                      |...||.:..:.:...|..:.     .....||...:|      ::::..:|.  
Human   128 ----------LLAKDLTKTCEFIVHSAPQKG-----KFTPSPVDFTITPETLQNVKERALLPK-- 175

  Fly   200 MLIHAHVRNDSSSDCRKLLIMLHLRATYTADTPSLRTTSEKIMLVKRE-CGPVAHNAQRTYTET- 262
            .|:..|:   :|::|   :|...|......::......|.::.||:.| || .|....|..||. 
Human   176 FLLRGHL---NSTNC---VITQPLTGELVVESSEAAIRSVELQLVRVETCG-CAEGYARDATEIQ 233

  Fly   263 ------------LRIPA--------TAPTCEHLSKVVRVSYEVRVVAVMNWLMANPRLIIPVTIG 307
                        |.:|.        |.||.|..:  .:|.:||.:|.:::               
Human   234 NIQIADGDVCRGLSVPIYMVFPRLFTCPTLETTN--FKVEFEVNIVVLLH--------------- 281

  Fly   308 NVPLATAVSGPDFLPTNAFP 327
                      ||.|.|..||
Human   282 ----------PDHLITENFP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 26/145 (18%)
Arrestin_C 179..308 CDD:280848 30/156 (19%)
VPS26CNP_006043.1 Arrestin_N 1..283 CDD:389964 58/335 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.