DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and arrdc4

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001107732.1 Gene:arrdc4 / 100135736 XenbaseID:XB-GENE-492296 Length:403 Species:Xenopus tropicalis


Alignment Length:414 Identity:89/414 - (21%)
Similarity:161/414 - (38%) Gaps:71/414 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DQNEHGTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQWRIRRHGKAVAIQNPKKRSKHQY 74
            ::.::| |..|:.:||.|::.:.:..::..:.|::.|.|..                .|:.|...
 Frog    13 NEGKYG-YCAGEPVTGYVLLEVLREIRVLSLLLRVCGGAMT----------------CKQGKQLE 60

  Fly    75 SGREDYIASTTYLMGSEQGSNFN----------MDAGTYTYTFACPIP-SHCPSSFEGAYGHIRY 128
            ...|.:..:|.||  :|:.|...          ..||.:...|...:| |...:||.|.||.:.|
 Frog    61 DAWEAFPQATHYL--NEEYSLLTEPAGDCEILLFPAGNHKIPFRFQLPESPLVTSFSGKYGKVYY 123

  Fly   129 LAKVTFLKPGASNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFCLMHTKPVQLKVTLQQQG 193
            .......:|.....|.:....||..:::|..:.......|.|.:.......:.|:.:...:.::|
 Frog   124 QTTAVLKRPSVPPHTTHRELRVLSPINVN
SPSLYTPVERSKEVMVGCWFFMSGPISVNAKIGRKG 188

  Fly   194 YVPGQFMLIHAHVRNDSSSDCRKLLIMLHLRATYTADTPSL--RTTSEKIMLVKRECGPVAHNAQ 256
            |..|:.:.|:|.:.|.||.      :::...|.|...:..|  :|.:.:.||.......:|..:.
 Frog   189 YCNGEAIHIYADIENGSSR------LIVPKAAIYQTQSFLLDGKTRTVRQMLASVRGNHIASGSA 247

  Fly   257 RTYT-ETLRIPATAPT---CEHLSKVVRVSYEVRVVAVMNWLMANP-RLIIPVTIGNVPLATAVS 316
            .::. :.|:||...|:   |    .::||.|.:.|  .:|...|.. ::.:|:.||.:||     
 Frog   248 DSWNGKALKIPPVTPSILEC----NIIRVEYSLAV--SINIPGAKKLKVELPLVIGTIPL----- 301

  Fly   317 GPDFLPTNAFPSGSSLPADLPCTSTRAMELAQMAASGVSNSGYEMAEDL-EDFELPEDGDDELEA 380
             .:|...|| ...|....|:   |..|:.|.:...:..:.:.....||| .|....||..|.||.
 Frog   302 -NEFNCRNA-SVASQFSMDM---SWLALALPEQPEAPPNYADIVSEEDLSRDISSMEDIGDVLEG 361

  Fly   381 ADDFVPDL---------PPPTYEQ 395
            .  ..|..         |||.|.:
 Frog   362 L--HCPPFAVIQEFRFQPPPLYSE 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 32/157 (20%)
Arrestin_C 179..308 CDD:280848 29/135 (21%)
arrdc4NP_001107732.1 Arrestin_N 7..152 CDD:304627 32/157 (20%)
Arrestin_C 175..301 CDD:214976 30/137 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 1 1.000 - - FOG0000089
OrthoInspector 1 1.000 - - mtm9421
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X122
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.