DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10086 and arrdc1a

DIOPT Version :9

Sequence 1:NP_649736.3 Gene:CG10086 / 40920 FlyBaseID:FBgn0037517 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_005171840.1 Gene:arrdc1a / 100006005 ZFINID:ZDB-GENE-030925-15 Length:447 Species:Danio rerio


Alignment Length:466 Identity:101/466 - (21%)
Similarity:184/466 - (39%) Gaps:99/466 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ITFDQNEHGTYFTGQVITGKVIVNLNKTKKLRGIKLQISGYAQAQWRIRRHGKAVAIQNPKKRSK 71
            ||||.|: ..|..|:.:||.:.:::.::.:.:.||:...|:...               ..|.:.
Zfish     9 ITFDNNK-TVYSPGESLTGTLKISIAQSIQCKAIKVNCQGFCGV---------------TSKSND 57

  Fly    72 HQYSGREDYIASTTYLMGSEQGSNFNMDAGTYTYTFACPIPSHCPSSFEGAYGHIRYLAKVTFLK 136
            ..::..|.|.:|:..:  :::|:   :..|.:::.|...:|:..|:||.|.||.|.|..:.....
Zfish    58 TDWTDEEQYFSSSVSI--ADKGT---LKEGEHSFPFKFLLPAAAPTSFVGPYGQIMYRVRAFIDT 117

  Fly   137 PG-ASNRTHNVGFTVLKLLDLNQETKMLREPASNEAVEHFCLMHTK--PVQLKVTLQQQGYVPGQ 198
            |. |.:......|::...|:|| |...:|||:|:...::|..|..|  .|.|......:||:.||
Zfish   118 PRFAKDYKIEKPFSMTNTLNLN
-EVPGIREPSSSSVTKNFSYMLVKNGTVVLNAKTDMRGYIAGQ 181

  Fly   199 FMLIHAHVRNDSSSDCRKLLIMLHLRATYTADTPS--LRTTSEKIMLVKRECGPVAHNAQRT-YT 260
            .:.:.|.:.|.|......::..|..:.||....|:  ||:.:|    |:   ||......:: :.
Zfish   182 IIKVSAGIENKSDKTTGHVVASLMQKVTYNTKKPTYDLRSVAE----VE---GPGVKGGNKSEWN 239

  Fly   261 ETLRIPATAPTCEHLSKVVRVSYEVRVVAVMNWLMANPR--LIIPVTIGNVPL------------ 311
            :.:.:||...:......::::.|.::|      .:..|.  |.:|:.||:|.|            
Zfish   240 QQIIVPALPHSSLSDGNLIQICYYIQV------YLKYPEVALTLPICIGSVALDPSQPSHSQTVA 298

  Fly   312 ---------ATAVSGPDFLPTNAFPSGSSLPADLP-CTSTRA------MELAQMAASGVSNSGYE 360
                     |.:.|.|:...:|..|..:..||..| ..||.|      ::|.....| |||...|
Zfish   299 PMPAPRITPAPSPSAPESEASNLPPRPAPKPAPKPRPRSTHASPSAPPVDLYPQLPS-VSNYNGE 362

  Fly   361 MAEDLEDFELPEDGDDELEAADDFV---------------PDLPPPTYEQAMFMTTDIADTDANT 410
            |.:....    |.|.....:.:.|.               |..|||:...        :..|.|.
Zfish   363 MLKSPHQ----EPGSQGPVSPNAFSYAPGLSFRQRQSSSGPSAPPPSLSS--------SSQDRNQ 415

  Fly   411 VSEASRFTPRY 421
            :..::...|.|
Zfish   416 MPSSASVPPSY 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10086NP_649736.3 Arrestin_N 5..157 CDD:278754 32/150 (21%)
Arrestin_C 179..308 CDD:280848 28/135 (21%)
arrdc1aXP_005171840.1 Arrestin_N 7..139 CDD:304627 32/150 (21%)
Arrestin_C 162..283 CDD:280848 28/133 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579469
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3780
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311636at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.