DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11286 and OAF3

DIOPT Version :9

Sequence 1:NP_649735.1 Gene:CG11286 / 40919 FlyBaseID:FBgn0037516 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_012990.1 Gene:OAF3 / 853938 SGDID:S000001772 Length:863 Species:Saccharomyces cerevisiae


Alignment Length:117 Identity:26/117 - (22%)
Similarity:41/117 - (35%) Gaps:35/117 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KSIPSAGDV--LRGKNVPVHRLNAKFVAKAQEKAKKVEEFLTRTKTTSLVSLSGLASRYEFHRLQ 72
            :|.||..|.  ||.::.|..|::..|:.|.:....:.:|                          
Yeast    58 ESSPSLNDADPLRKQSTPAERISPGFIKKRRSSQTRQDE-------------------------- 96

  Fly    73 ELDEWYEPRIKFHDEADASLH--PSYDIKHFQYDLNCYVRYLDSKAKYDRQF 122
              |.|...|   ..|..:||:  |.::...|..||.....||::|...|..|
Yeast    97 --DHWQRVR---ELENQSSLYYLPIHEETPFFIDLIPNGFYLETKRSADNLF 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11286NP_649735.1 DUF4790 92..184 CDD:292656 10/33 (30%)
OAF3NP_012990.1 GAL4 13..54 CDD:214501
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4964
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.