DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11286 and CG10919

DIOPT Version :9

Sequence 1:NP_649735.1 Gene:CG11286 / 40919 FlyBaseID:FBgn0037516 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_649733.2 Gene:CG10919 / 40917 FlyBaseID:FBgn0037514 Length:187 Species:Drosophila melanogaster


Alignment Length:141 Identity:40/141 - (28%)
Similarity:69/141 - (48%) Gaps:12/141 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SGLASRYEFHR----------LQELDEWYEP--RIKFHDEADASLHPSYDIKHFQYDLNCYVRYL 112
            :..|:.|..|:          :.:..|.|.|  :..|.|:.|....|::........:.|..||.
  Fly    47 NAFAAMYRRHKADAQYVNNNYVDDPVEEYVPIYQTVFDDDRDPVHEPTFSKHRIPLQIRCLERYH 111

  Fly   113 DSKAKYDRQFLHEMEHIIANQRNICDQFFLKKILCYKTMWPPLHTKRELNNFVSKFFQLPPKEKR 177
            :||.:|..||..|::.:|.||....:.:...:.:.|.|:||||||::||..|...|.:|.|:|::
  Fly   112 NSKREYADQFKREIKLLIDNQSTAQEAWQFVRTMAYTTLWPPLHTRKELKIFELDFCKLNPQEQK 176

  Fly   178 RVEYLLKTDLS 188
            |...::.|:.|
  Fly   177 RYNKIMATNFS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11286NP_649735.1 DUF4790 92..184 CDD:292656 29/91 (32%)
CG10919NP_649733.2 DUF4790 91..182 CDD:292656 29/90 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449438
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.