DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11286 and CG42650

DIOPT Version :9

Sequence 1:NP_649735.1 Gene:CG11286 / 40919 FlyBaseID:FBgn0037516 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001189191.1 Gene:CG42650 / 10178825 FlyBaseID:FBgn0261502 Length:188 Species:Drosophila melanogaster


Alignment Length:171 Identity:39/171 - (22%)
Similarity:74/171 - (43%) Gaps:33/171 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FLTRTKTTSLVSLSGLASRYE--FH----RLQELDEWYEPRIKFHDEADASLHPSYDIKHFQY-- 103
            |.||..||..::.....::::  .|    .|....:.:|..::|..|.|    .:.|.:.|:|  
  Fly    22 FSTRYTTTMGIAFGRQTTKFDIPIHDSRAMLDRNVKRHEDDVRFVGEFD----DTEDARFFKYTP 82

  Fly   104 ---------------------DLNCYVRYLDSKAKYDRQFLHEMEHIIANQRNICDQFFLKKILC 147
                                 ::||..|......:|:.|..:|:..:|..|:|..:..:..|::.
  Fly    83 VFDDRDICPKDPSFTKFKCPMEINCKERLKKDTVRYNNQLKNEISKLIDYQKNALEAAYFVKVMS 147

  Fly   148 YKTMWPPLHTKRELNNFVSKFFQLPPKEKRRVEYLLKTDLS 188
            |.|:|||.|:..|:.|....|::|..||:.|.::::..|.|
  Fly   148 YTTLWPPYHSNLEIANTSRTFYRLSKKEQARYDFIMSHDFS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11286NP_649735.1 DUF4790 92..184 CDD:292656 26/114 (23%)
CG42650NP_001189191.1 DUF4790 92..184 CDD:292656 23/91 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449437
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCZB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.