DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and gzma

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:267 Identity:75/267 - (28%)
Similarity:107/267 - (40%) Gaps:58/267 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRLG 201
            :..|.|.. ...:||..::...|.     .|||.||:..:|||||||...:..:     .||.:|
Zfish    28 IVGGKDVK-KALSWMVSIQVNQNH-----KCGGILIHKEWVLTAAHCKEDSYSS-----VTVLIG 81

  Fly   202 EYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPA---NKNRIHDIALLRLDRPVVLNEYIQPV 263
            ....||                |.::..:|....|.   .|.:..||.|:||.:.|....|..| 
Zfish    82 SLSLSK----------------GSQRIAIHNYEIPETFNKKTKKDDIMLIRLSKKVKAKPYKIP- 129

  Fly   264 CLPLVSTRMAINTGELLVVSGWGRTTTARK--STIKQRLDLPVNDHDYCARKFATRNIHLISSQL 326
                 .....:..|...||.|||.|....|  |...|.|::.|.|...|.| :..||..:....|
Zfish   130 -----KKEKDVQPGTKCVVRGWGTTDYKGKQASDKLQMLEVLVVDRVQCNR-YYNRNPVITKDML 188

  Fly   327 CVGG-EFYRDSCDGDSGGPLMRRGFDQAWYQE------GVVSFGNRCGLEGWPGVYTRVAD-YMD 383
            |.|. :.:|.:|.|||||||           |      ||:|..:.||....|.|||.::. ::.
Zfish   189 CAGNTQQHRGTCLGDSGGPL-----------ECEKNLVGVLSGSHGCGDPKKPTVYTLLSKRHIT 242

  Fly   384 WIVETIR 390
            ||.:.::
Zfish   243 WINKILK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 73/260 (28%)
Tryp_SPc 137..388 CDD:238113 75/263 (29%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 75/263 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587293
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.