DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and zgc:153968

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:270 Identity:85/270 - (31%)
Similarity:127/270 - (47%) Gaps:38/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 CGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHC----VIGAV 188
            ||......::..|.......:.|...:.|:...|   |.|||:|||..:||:||.|    ....:
Zfish    27 CGRAPLKPRIIGGQTAMAGSWPWQVSIHYIPTGG---LLCGGTLINREWVLSAAQCFQKLTASNL 88

  Fly   189 ETEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPA-NKNRIHDIALLRLDR 252
            ...:|||:|   |:          .::.:.|..|:     ..||:||.| |||   |||||:|..
Zfish    89 VVHLGHLST---GD----------PNVIHNPASQI-----INHPKYDSATNKN---DIALLKLST 132

  Fly   253 PVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTT--ARKSTIKQRLDLPVNDHDYCARKFA 315
            ||...:||:|||  |.::..::..|.:..::|||...|  .:..|..|.:.:||..:..|...:.
Zfish   133 PVSFTDYIKPVC--LTASGSSLGKGAVSWITGWGSINTGGTQFPTTLQEVKIPVVSNGDCKSAYG 195

  Fly   316 TRNIHLISSQLCVG-GEFYRDSCDGDSGGPLMRRGFDQAWYQEGVVSFGNRCGLEGWPGVYTRVA 379
            :.   :....:|.| .|..:..|.||.||||:....:| |.|.|:.|||..|.....|||:|||:
Zfish   196 SL---ITDGMICAGPNEGGKGICMGDGGGPLVHNSSEQ-WIQSGIASFGRGCAQPKNPGVFTRVS 256

  Fly   380 DYMDWIVETI 389
            :|..||...|
Zfish   257 EYESWIKSQI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 80/256 (31%)
Tryp_SPc 137..388 CDD:238113 82/258 (32%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 80/256 (31%)
Tryp_SPc 36..265 CDD:238113 82/258 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.