DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and zgc:123217

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:266 Identity:77/266 - (28%)
Similarity:136/266 - (51%) Gaps:29/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KCGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETE 191
            :||....:.::..|.|.....:.|...:.| :||.    .|||:||::::|:|||||:|   .|.
Zfish    27 ECGVAPLNTRIVGGTDAPAGSWPWQVSIHY-NNRH----ICGGTLIHSQWVMTAAHCII---NTN 83

  Fly   192 VGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVVL 256
            : ::.|:.||....|..|      .|...:::||:....||.::.:..|  :||:|::|.:||..
Zfish    84 I-NVWTLYLGRQTQSTSV------ANPNEVKVGIQSIIDHPSFNNSLLN--NDISLMKLSQPVNF 139

  Fly   257 NEYIQPVCLPLVSTRMAINTGELLVVSGWGR----TTTARKSTIKQRLDLPVNDHDYCARKFATR 317
            :.||:|:|  |.:.......|.....:|||.    .......|: |::.:||..:..|:.::.:.
Zfish   140 SLYIRPIC--LAANNSIFYNGTSCWATGWGNIGKDQALPAPQTL-QQVQIPVVANSLCSTEYESV 201

  Fly   318 NIHLISSQLCVGGEFYRDSCDGDSGGPLM-RRGFDQAWYQEGVVSFGNR--CGLEGWPGVYTRVA 379
            |...|:.|:...|:..:.:|.||||||.. ::|  ..|.|.|:.|:|..  |.:..:|.||:||:
Zfish   202 NNATITPQMICAGKANKGTCQGDSGGPFQCKQG--SVWIQAGITSYGTSAGCAVGAYPDVYSRVS 264

  Fly   380 DYMDWI 385
            ::..||
Zfish   265 EFQSWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 73/255 (29%)
Tryp_SPc 137..388 CDD:238113 75/256 (29%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 73/255 (29%)
Tryp_SPc 37..273 CDD:238113 75/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.