DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG34458

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:266 Identity:79/266 - (29%)
Similarity:119/266 - (44%) Gaps:59/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 NKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVR 199
            :::..|...|..:|.....|:.   .||..  ||||||::..::|||||.:|   ...|.:..: 
  Fly    30 SRIIGGQFAAPGQFPHQVSLQL---NGRHH--CGGSLISDTMIVTAAHCTMG---QNPGQMKAI- 85

  Fly   200 LGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVVLNEYIQPVC 264
            :|..|.|....          ....|.|..:||:|:|.:::  .|::|::|..||.:...:|.:.
  Fly    86 VGTNDLSAGNG----------QTFNIAQFIIHPRYNPQSQD--FDMSLIKLSSPVPMGGAVQTIQ 138

  Fly   265 LPLVSTRMAINTGELLVVSGWGRTTTARKSTIKQRLDLP---------VNDHDYCARKFATRNI- 319
            |....:..|.:|  :.::||:|        .|.|.|.||         :...|||    .::|| 
  Fly   139 LADSDSNYAADT--MAMISGFG--------AINQNLQLPNRLKFAQVQLWSRDYC----NSQNIP 189

  Fly   320 HLISSQLCVG---GEFYRDSCDGDSGGPLMRRG--FDQAWYQEGVVSFGNRCGLEGWPGVYTRVA 379
            .|....:|.|   |:.  .||.|||||||...|  |       ||||:|..||.:|.|.:||.|.
  Fly   190 GLTDRMVCAGHPSGQV--SSCQGDSGGPLTVDGKLF-------GVVSWGFGCGAKGRPAMYTYVG 245

  Fly   380 DYMDWI 385
            ....||
  Fly   246 ALRSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 77/263 (29%)
Tryp_SPc 137..388 CDD:238113 79/264 (30%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 77/263 (29%)
Tryp_SPc 32..254 CDD:238113 79/264 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.