DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:96 Identity:36/96 - (37%)
Similarity:57/96 - (59%) Gaps:6/96 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 TIKQRLDLPVNDHDYCARKF-ATRNIHLISSQLCVGGEFYRDSCDGDSGGPLMRRGFDQAWYQEG 358
            |::|.: :||..:..|.... ||...:::.:.|..||   :|:|.||||||::.:.. ..|.|.|
Zfish    15 TLQQTV-VPVVINSDCNNLLGATITDNMMCAGLLQGG---KDTCQGDSGGPMVSQQC-SVWVQSG 74

  Fly   359 VVSFGNRCGLEGWPGVYTRVADYMDWIVETI 389
            ::|.|:.||....|||||||:.|.:||:.:|
Zfish    75 IISKGHDCGQPYEPGVYTRVSQYQNWIMSSI 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 33/90 (37%)
Tryp_SPc 137..388 CDD:238113 35/93 (38%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 35/92 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.