DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and masp2

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001116330.1 Gene:masp2 / 560277 ZFINID:ZDB-GENE-060130-154 Length:684 Species:Danio rerio


Alignment Length:278 Identity:91/278 - (32%)
Similarity:146/278 - (52%) Gaps:35/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 PKCG-PHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVE 189
            |.|| |....:||..|.:...:|..|..::    ..|.:.:. |.||:::.:|||||| |:.:.|
Zfish   424 PICGQPELKLSKVIGGENAEKNEIPWQVMI----RMGTKFIG-GASLLSDGWVLTAAH-VVKSFE 482

  Fly   190 TEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQAT-VHPQYDPANKNRIHDIALLRLDRP 253
            ....  ..:|:|   |.|..|      |:.:  :||.|.. :||||...|.|..|||||::|:..
Zfish   483 DSAN--LQLRMG---TVKHHD------NEAV--VGIPQKIFIHPQYHHDNVNFNHDIALIKLEYK 534

  Fly   254 VVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRT---TTARKSTIKQRLDLPVNDHDYCARKF- 314
            |.:::.:.|||||....|..:...::..|||||.:   |.|..|...:.:.|||::.:.|..|: 
Zfish   535 VPVSKAVMPVCLPGREERFVLKANDVGKVSGWGVSNINTPALFSGNLKYVHLPVSNFNDCKTKYD 599

  Fly   315 ----ATRNIHLISSQLCVG-GEFYRDSCDGDSGGPLMRRGFD---QAWYQEGVVSFGNRCGLEGW 371
                :...:.:..:.:|.| .:..:|||.||||||.  ..||   ::|:..|:||:|:.|...|:
Zfish   600 STVTSKGKLVVTENMICAGFSQGGKDSCQGDSGGPF--AFFDKQSKSWFIGGIVSWGHGCAQAGY 662

  Fly   372 PGVYTRVADYMDWIVETI 389
            .||||:|::|:.||.|.:
Zfish   663 YGVYTKVSNYLSWIEEVM 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 84/261 (32%)
Tryp_SPc 137..388 CDD:238113 85/263 (32%)
masp2NP_001116330.1 CUB 24..130 CDD:214483
EGF_CA 134..176 CDD:214542
CUB 180..289 CDD:278839
CCP 296..357 CDD:214478
CCP 362..410 CDD:153056
Tryp_SPc 435..676 CDD:214473 84/261 (32%)
Tryp_SPc 436..679 CDD:238113 85/263 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.