DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and zgc:112038

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:268 Identity:87/268 - (32%)
Similarity:132/268 - (49%) Gaps:31/268 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 CGPHSFSNKVYNGNDTAI-DEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETE 191
            ||....:|.  ||.|.|: ..:.|.|.:..:   ...:..|||||||..:||:||||.:......
Zfish    27 CGQAPLNNN--NGGDDAVAGSWPWQASIHRI---SPEDHICGGSLINKDWVLSAAHCFMITATAN 86

  Fly   192 VGHLTTVRLG-EYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVV 255
            :    .:.|| ::.|..         |...:...:.|..:||.|....:|  :|||||||...|.
Zfish    87 I----KIFLGRQFQTGS---------NPNEISRTLTQIVIHPDYSTTTQN--NDIALLRLSSSVT 136

  Fly   256 LNEYIQPVCLPLVSTRMAINTGELLVVSGWG--RTTTARKSTIKQRLDLPVNDHDYCARKFATRN 318
            ..:||:||||....:..|..|...  ::||.  |::..:.:.:.|.:.|||..:..|...:  :.
Zfish   137 FTDYIRPVCLASADSVFAGGTKSW--ITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNADY--KG 197

  Fly   319 IHLISSQLCVG-GEFYRDSCDGDSGGPLMRRGFDQAWYQEGVVSFGNRCGLEGWPGVYTRVADYM 382
            | :..:.:|.| .|..:|:|.||||||::.:. ...|.|.|:||||..|||..:||:||||:.|.
Zfish   198 I-ITDNMICAGINEGGKDACQGDSGGPMVSQN-GSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQ 260

  Fly   383 DWIVETIR 390
            .||...:|
Zfish   261 SWITSELR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 81/253 (32%)
Tryp_SPc 137..388 CDD:238113 83/255 (33%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 80/249 (32%)
Tryp_SPc 37..263 CDD:238113 80/249 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.