DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and prss60.2

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:271 Identity:86/271 - (31%)
Similarity:129/271 - (47%) Gaps:36/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 CGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETE- 191
            ||....::::..|.:.....:.|...|:.....|.   .||||||::.:|||||||:.|..|:. 
Zfish    25 CGQAPLNSRIVGGVNAPEGSWPWQVSLQSPRYGGH---FCGGSLISSEWVLTAAHCLPGVSESSL 86

  Fly   192 ---VGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRP 253
               :|..|...:..::||::|                .:..||..|: :|.|. :|||||||...
Zfish    87 VVYLGRRTQQGVNTHETSRNV----------------AKIIVHSSYN-SNTND-NDIALLRLSSA 133

  Fly   254 VVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRT---TTARKSTIKQRLDLPVNDHDYCARKFA 315
            |..|:||:|||  |.:.....:.|....::|||..   .......|.|...:||..:|.|..:..
Zfish   134 VTFNDYIRPVC--LAAQNSVYSAGTSSWITGWGDVQAGVNLPAPGILQETMIPVVANDRCNAQLG 196

  Fly   316 TRNI--HLISSQLCVGGEFYRDSCDGDSGGPLMRRGFDQAWYQEGVVSFGNRCGLEGWPGVYTRV 378
            :..:  ::|.:.|..||   :|:|.||||||::.| ....|.|.|:.|:|..|.....|||||||
Zfish   197 SGTVTNNMICAGLAKGG---KDTCQGDSGGPMVTR-LCTVWIQAGITSWGYGCADPNSPGVYTRV 257

  Fly   379 ADYMDWIVETI 389
            :.|..||...|
Zfish   258 SQYQSWISSKI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 81/257 (32%)
Tryp_SPc 137..388 CDD:238113 83/259 (32%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 81/257 (32%)
Tryp_SPc 34..267 CDD:238113 83/259 (32%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.