DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and zgc:92313

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001002596.1 Gene:zgc:92313 / 436869 ZFINID:ZDB-GENE-040718-339 Length:309 Species:Danio rerio


Alignment Length:276 Identity:84/276 - (30%)
Similarity:128/276 - (46%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KCGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELS-CGGSLINNRYVLTAAHCVIGAVET 190
            :||.....|::..|:..|...:.|.     ||.:|.:... |||::|:..:||:||||.....:.
Zfish    25 ECGRPPMINRIVGGSSAADGAWPWQ-----VDIQGEKSKHVCGGTIISENWVLSAAHCFPNPNDI 84

  Fly   191 EVGHLTTVRLGEY--------DTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIAL 247
            . |:|  :..|..        :||..:       ::.::.||.    ..||..       .||||
Zfish    85 S-GYL--IYAGRQQLNGWNPDETSHRI-------SRVVVPLGY----TDPQLG-------QDIAL 128

  Fly   248 LRLDRPVVLNEYIQPVCLPLVSTRMAINTGEL-LVVSGWG--RTTTARKST-IKQRLDLPVNDHD 308
            :.|..|.|..|.|||||||..:...   |.:: .:::|||  |...|.:.. ..|.:.:|:.|..
Zfish   129 VELATPFVYTERIQPVCLPYANVEF---TSDMRCMITGWGDIREGVALQGVGPLQEVQVPIIDSQ 190

  Fly   309 YCARKF---ATRNIHLISSQLCVG-GEFYRDSCDGDSGGPLMRRGFDQAWYQEGVVSFGNRCGLE 369
            .|...|   .|.||.:....:|.| .:..:|||.|||||||..:..|.:|.|.|:||||..|...
Zfish   191 ICQDMFLTNPTENIDIRPDMMCAGFQQGGKDSCQGDSGGPLACQISDGSWVQAGIVSFGLGCAEA 255

  Fly   370 GWPGVYTRVADYMDWI 385
            ..||||.:|:.:.::|
Zfish   256 NRPGVYAKVSSFTNFI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 80/265 (30%)
Tryp_SPc 137..388 CDD:238113 81/266 (30%)
zgc:92313NP_001002596.1 Tryp_SPc 34..271 CDD:214473 80/265 (30%)
Tryp_SPc 35..274 CDD:238113 81/266 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587315
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.