DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG9733

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:427 Identity:173/427 - (40%)
Similarity:242/427 - (56%) Gaps:62/427 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IFLATCLLPFTVLQNVAAQGS--CRNPNQKQGQCLSIYDCQSLLSVIQQSYVSPEDRTFLRNSQC 72
            :||  |:|   :.....||..  |.||||..|.|:.|.:||:|.||::::.::.::::|:::|.|
  Fly     7 VFL--CIL---IAHEAKAQSDSRCLNPNQTPGLCVLINECQTLYSVLKRATLTDQEKSFIKSSAC 66

  Fly    73 LDGVGRQPYVCCTSDR----------------------------------------SFGSQEATS 97
            ..|...|||||||.|.                                        |||:|.|||
  Fly    67 GRGSNNQPYVCCTQDTGYVRIQRQDRTFPDYGAFGGDWEEERPQSFVFPRQERRPWSFGNQPATS 131

  Fly    98 AAPPPTTTSSSSRGQDGQAGLGNLLPSPPKCGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGR 162
            ..  |...||:|.|       .:|||.||.||.....|::|:|.||.::||.||.||||....|.
  Fly   132 RT--PFRKSSTSDG-------SSLLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGN 187

  Fly   163 -RELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRLGEYDTSKDVDCI--DDICNQPILQLG 224
             ...:|.|||||.|||||||||:.|.:|.|||.|.:|||||:||...|||.  ...|:..:.:||
  Fly   188 GLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRLG 252

  Fly   225 IEQATVHPQYDPANKNRIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTT 289
            .|:..||.:|.....|::|||.|:|::|.|..::.|||:|||......:..:|:...|:|||||.
  Fly   253 FEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTL 317

  Fly   290 TARKSTIKQRLDLPVNDHDYCARKFATRNIHLISSQLCVGGEFYRDSCDGDSGGPLMRRGF-DQA 353
            ...:|.:||::.:...|...|.::|:...::|..:|||.||:|.:|||||||||||||  | |::
  Fly   318 KMARSAVKQKVTVNYVDPAKCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMR--FRDES 380

  Fly   354 WYQEGVVSFGNRCGLEGWPGVYTRVADYMDWIVETIR 390
            |..||:||||.:|||:.||||||.||.|..||.:.:|
  Fly   381 WVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNVR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855 21/52 (40%)
Tryp_SPc 136..385 CDD:214473 119/252 (47%)
Tryp_SPc 137..388 CDD:238113 121/254 (48%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855 21/52 (40%)
Tryp_SPc 161..412 CDD:214473 119/252 (47%)
Tryp_SPc 162..415 CDD:238113 121/254 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447731
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0014395
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.