DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and aqrs

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:210 Identity:47/210 - (22%)
Similarity:84/210 - (40%) Gaps:47/210 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LLEYVDNRGRRELSCGGSLINNRYVLTAAHC-------VIGAVETEVGHLTTVRLGEYDTSKDVD 210
            |..||:......:.|.|:||:.|.|:|:.||       :|  .|....||:.:...|.|.:.   
  Fly    75 LTYYVNVLNEGSVICAGALISRRMVVTSTHCFQPRRFDLI--YEYTAKHLSILTGVELDDNP--- 134

  Fly   211 CIDDICNQPILQLGIEQATVHPQYDPANKNR--IHDIALLRLDRPVVLNEYIQPVCLPLVSTRMA 273
                   :|...:|.        :.|.|||.  .:.:|||.|...:..::|..   :||  .|..
  Fly   135 -------EPHQVIGF--------FMPVNKNERFTNYVALLALSNKLDRDKYRY---IPL--HRKK 179

  Fly   274 INTGELLVVSGWGRTTTARKSTIKQRL-DLPVNDHDYCARKFATRNIHLISS----QLCVGGEFY 333
            ...|:.:.::.:|      ....:.|| :..|.|.|.|...:..:.:..:|:    .:||..:.:
  Fly   180 PQAGDDVKMAYYG------PPKFQIRLYNTRVMDIDRCKIHYGLKEVFHVSTFEPDFICVRNKRH 238

  Fly   334 --RDSCDGDSGGPLM 346
              :.:|....|.||:
  Fly   239 SKKTTCSTRPGDPLL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 47/210 (22%)
Tryp_SPc 137..388 CDD:238113 47/210 (22%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 44/203 (22%)
Tryp_SPc 83..268 CDD:304450 44/202 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.