DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG11836

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:265 Identity:91/265 - (34%)
Similarity:140/265 - (52%) Gaps:37/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 CGPHSFSN---KVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVE 189
            ||   |||   ::..|..|.::::.|||.:.| |.:    ..|||||:...|||:|||||....:
  Fly    88 CG---FSNEEIRIVGGKPTGVNQYPWMARIVY-DGK----FHCGGSLLTKDYVLSAAHCVKKLRK 144

  Fly   190 TEVGHLTTVRLGEYD---TSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLD 251
            :::    .|..|::|   ||:          ...:|..:.....|..:||...|  :|||||||.
  Fly   145 SKI----RVIFGDHDQEITSE----------SQAIQRAVTAVIKHKSFDPDTYN--NDIALLRLR 193

  Fly   252 RPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTARK-STIKQRLDLPVNDHDYCARKFA 315
            :|:..::.|:|:|||..:...|   |.:..|.|||||:...: .:|..::.:|:.....| |...
  Fly   194 KPISFSKIIKPICLPRYNYDPA---GRIGTVVGWGRTSEGGELPSIVNQVKVPIMSITEC-RNQR 254

  Fly   316 TRNIHLISSQLCVGGEFYRDSCDGDSGGPLMRRGFDQAWYQEGVVSFGNRCGLEGWPGVYTRVAD 380
            .::..:.||.||.|.. ..|||.|||||||:... ...::..|:||:|..||.||:||||:||:.
  Fly   255 YKSTRITSSMLCAGRP-SMDSCQGDSGGPLLLSN-GVKYFIVGIVSWGVGCGREGYPGVYSRVSK 317

  Fly   381 YMDWI 385
            ::.||
  Fly   318 FIPWI 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 84/252 (33%)
Tryp_SPc 137..388 CDD:238113 86/253 (34%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 86/253 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457375
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.