DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG3505

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:369 Identity:135/369 - (36%)
Similarity:199/369 - (53%) Gaps:64/369 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GQCLSIYDCQSLLSVIQQSYVSPEDRTFLRNSQCLDGV-GRQPYVCCTSDRSFGSQEATSAAPPP 102
            |.|:||.:|...:.::....:|..||..||::||  || |....|||                 |
  Fly    38 GHCISIRECDYFMRILLSGNLSQSDRNLLRDNQC--GVRGNDVQVCC-----------------P 83

  Fly   103 TTTSSSSRGQDGQAGLG----NLLPSPPKCGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRR 163
            :|           ||||    .||||  .||...:...  |..||.|.||.|:||:||  .||.:
  Fly    84 ST-----------AGLGALTHPLLPS--DCGKVRWQRS--NDTDTRIREFPWLALIEY--TRGNQ 131

  Fly   164 EL--SCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRLGEYDTSKDVDC-------IDDICNQP 219
            |.  :|||.||::||||||||||..|..:.: .:|.|||||:|||.:.||       :.| |..|
  Fly   132 EKIHACGGVLISDRYVLTAAHCVAQAATSNL-QITAVRLGEWDTSTNPDCQYHEDSKVAD-CAPP 194

  Fly   220 ILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLV--V 282
            ...:.||:...||.|:..::.:|:||||:||..|..||:::||:|||  :.::..:..|.||  |
  Fly   195 YQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLP--NKQLRADELEDLVTEV 257

  Fly   283 SGWGRTTTARKSTIKQRLDLPVNDHDYCARKFATRNIHLISSQLCVGGEFYRDSCDGDSGGPLMR 347
            :||..:::.|    .::..:.::..:.|.||:|::.:.:.:|:||  |......|.|::|||||.
  Fly   258 AGWQASSSQR----MRKGYVTISSIEECQRKYASQQLRIQASKLC--GLTNSQECYGNAGGPLML 316

  Fly   348 RGFDQAWYQEGVVSFGN-RCGLEGWPGVYTRVADYMDWIVETIR 390
            ...| .:...|:||||. .|....||.||||||.|:|||.::::
  Fly   317 FKND-GYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHDSLK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855 16/45 (36%)
Tryp_SPc 136..385 CDD:214473 103/260 (40%)
Tryp_SPc 137..388 CDD:238113 105/262 (40%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855 16/45 (36%)
Tryp_SPc 111..356 CDD:238113 104/257 (40%)
Tryp_SPc 111..354 CDD:214473 102/255 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.