DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG6865

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:296 Identity:94/296 - (31%)
Similarity:144/296 - (48%) Gaps:62/296 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KCGPH--SFSN--------KVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAA 181
            ||...  :|||        |:..|::...:|..:|..|.   .||..  .|||::|:.|::|||.
  Fly    15 KCAQSQIAFSNQPCSVRNPKIVGGSEAERNEMPYMVSLM---RRGGH--FCGGTIISERWILTAG 74

  Fly   182 HCVIGA---------VETEVGHLTTVRLGEYDTSKDVDCIDDICNQP-ILQLGIEQATVHPQYDP 236
            ||:...         ::..|| |.::|  ||        ::.|.|.| .|::..:....||||| 
  Fly    75 HCICNGLQQFMKPAQIQGVVG-LHSIR--EY--------LNGIGNGPDALRVDFKNIVPHPQYD- 127

  Fly   237 ANKNRIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWG----------RTTTA 291
            .|..: ||||||.|.:|:..:.:|||.|:.......::.. |...|||||          |:...
  Fly   128 CNDVK-HDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQ-EYGTVSGWGWTHENQAENDRSDVL 190

  Fly   292 RKSTIKQRLDLPVNDHDYCARKFAT--RNIHLISSQLCVGGEFYR-DSCDGDSGGPLMRRGFDQA 353
            ||:|:|      :.:::.|.|.:.:  ::..:..:|||.|.|..: |||..|||||||    .:.
  Fly   191 RKATVK------IWNNEACERSYRSLGKSNTIGETQLCAGYENGQIDSCWADSGGPLM----SKE 245

  Fly   354 WYQEGVVSFGNRCGLEGWPGVYTRVADYMDWIVETI 389
            .:..||||.|..|...|.||:||||:.|:.|:.:.|
  Fly   246 HHLVGVVSTGIGCARPGLPGIYTRVSKYVSWMQKVI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 87/271 (32%)
Tryp_SPc 137..388 CDD:238113 87/273 (32%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 87/270 (32%)
Tryp_SPc 35..280 CDD:238113 87/273 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.