DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG1299

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:382 Identity:121/382 - (31%)
Similarity:178/382 - (46%) Gaps:59/382 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CRNPNQKQGQCLSIYDCQSLLSVIQQSYVSPEDRTFLR--NSQCLDGVGRQPYVCCTSDRSFGSQ 93
            ||.|:.|.|.|:.|.:|.|||:.::..........|||  |:.| ...|.|  |||.:.:...: 
  Fly   164 CRGPDTKPGNCVEIKECASLLNELRSRSQDATFANFLRASNAVC-QNKGTQ--VCCPTGQGITN- 224

  Fly    94 EATSAAP----PPTTTSSSSRGQDGQAGLGNLLPSPPKCGPHSFSNKVYNGNDTAIDEFNWMALL 154
              |:.||    |..|.....|..:.:.|.|:.:         .:..|:..|..:....:.|:|||
  Fly   225 --TTPAPSQIVPKNTDEIPRRLLNVEEGCGSTV---------GYFKKIVGGEVSRKGAWPWIALL 278

  Fly   155 EYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRLGEYDTSKDVDC--IDDICN 217
            .|.|..| ....|||:||..|:|||||||:       ...|..|||||:|.|.|.:.  :|    
  Fly   279 GYDDPSG-SPFKCGGTLITARHVLTAAHCI-------RQDLQFVRLGEHDLSTDTETGHVD---- 331

  Fly   218 QPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVVLNEYIQPVCLP-LVSTRMAINTGELLV 281
                 :.|.:...||.|:  .:|...|:|:|.|:|.|.....|.|:||| ..:.|.....|.:..
  Fly   332 -----INIARYVSHPDYN--RRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPF 389

  Fly   282 VSGWGRTTTARKST-IKQRLDLPVNDHDYCARKFATRNIHLISSQ-----LCV----GGEFYRDS 336
            |:|||:|....:|. :...|.:|:.|:..|.:.:|....:..:.|     ||.    ||   :|:
  Fly   390 VAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGG---KDT 451

  Fly   337 CDGDSGGPLMRRGFDQA---WYQEGVVSFGNRCGLEGWPGVYTRVADYMDWIVETIR 390
            |.||||||||.....|.   :|..||||:|..|.....||||:....:||||::.::
  Fly   452 CQGDSGGPLMLPEPYQGQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWIIQQVQ 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855 19/54 (35%)
Tryp_SPc 136..385 CDD:214473 90/264 (34%)
Tryp_SPc 137..388 CDD:238113 91/266 (34%)
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 19/54 (35%)
Tryp_SPc 260..503 CDD:214473 90/264 (34%)
Tryp_SPc 261..503 CDD:238113 89/263 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.920

Return to query results.
Submit another query.