DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG30414

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:304 Identity:100/304 - (32%)
Similarity:141/304 - (46%) Gaps:51/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 QDGQAGLGNLLPSPPKCG--PHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINN 174
            |.|:...|:||.|  .||  ...|...:..|.|..:....||.       :...|..||||||.:
  Fly    16 QLGEGAPGHLLDS--SCGTTKPEFIPMITGGADAGLFSNPWMV-------KVLGEKLCGGSLITS 71

  Fly   175 RYVLTAAHCVIGA-VETEVGHLTT-------------------VRLGEYDTS-KDVDCIDDICNQ 218
            |:|||||||::.. :...:|...|                   :|||||||. ...||    |..
  Fly    72 RFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDC----CVP 132

  Fly   219 PILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVS 283
            ...:|.:::..:|..|   |.|..:||.|||:...|..::|::|:|| ||...||  ...:..::
  Fly   133 KSYELAVDRKILHADY---NLNLDNDIGLLRMKSFVQYSDYVRPICL-LVEGHMA--ESPIFNIT 191

  Fly   284 GWGRTTTARKSTIKQRLDLPVNDHDYCARKFATRNIHLISSQLCVGGEFYRDSCDGDSGGPLMRR 348
            |||.|.....|...||..:...|..:|..|| |:.:.  .||:|..|. ..|:|.|||||||..:
  Fly   192 GWGVTNDGTPSRRLQRATVYNTDLHFCRSKF-TKQVD--ESQICAAGT-NSDACHGDSGGPLSAQ 252

  Fly   349 -GFDQAW--YQEGVVSFGNRCGLEGWPGVYTRVADYMDWIVETI 389
             .|..:|  :|.|:||:|: .....: .|||.|..:.||||..|
  Fly   253 VPFAGSWLTFQYGLVSYGS-AACHSF-SVYTNVTHHRDWIVNAI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 87/272 (32%)
Tryp_SPc 137..388 CDD:238113 90/274 (33%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 87/271 (32%)
Tryp_SPc 41..290 CDD:238113 87/271 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.