DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG9294

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:327 Identity:106/327 - (32%)
Similarity:161/327 - (49%) Gaps:62/327 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PYVCCTSDRSFGSQEATSAAPPPTTTSSSSRGQDGQAGLGNLLPSPP--------KCGPHSFSNK 136
            |.|..||         |:.....||:|::||....:..:.|.    |        :||..:...|
  Fly    49 PVVATTS---------TTTRRTTTTSSTTSRTTTSRTTVANF----PIERDCVTCRCGLINTLYK 100

  Fly   137 VYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRLG 201
            :..|.:|.:.::.|||:: .:.||    ..|.|||||:.|||||||||.| |..|   |.|:|..
  Fly   101 IVGGQETRVHQYPWMAVI-LIYNR----FYCSGSLINDLYVLTAAHCVEG-VPPE---LITLRFL 156

  Fly   202 EYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVVLNEY-IQPVCL 265
            |::.|...|.|       ::|..:.:..||..|:|.:.:  :|:|:|||::|:.:..: ::|:||
  Fly   157 EHNRSHSNDDI-------VIQRYVSRVKVHELYNPRSFD--NDLAVLRLNQPLDMRHHRLRPICL 212

  Fly   266 PLVSTRMAINTGELLVVSGWGR-------TTTARKSTIKQRLDLPVNDHDYCARKFATRNIHLIS 323
            |:.|...   ..||.:|:|||.       |.|.|:      :|:.|.....|......|...:..
  Fly   213 PVQSYSF---DHELGIVAGWGAQREGGFGTDTLRE------VDVVVLPQSECRNGTTYRPGQITD 268

  Fly   324 SQLCVG--GEFYRDSCDGDSGGPLMRRGFDQ--AWYQ-EGVVSFGNRCGLEGWPGVYTRVADYMD 383
            :.:|.|  .|..:|:|.||||||| :..||:  ..|| .|:||:|..|.....|||||||..|:.
  Fly   269 NMMCAGYISEGGKDACSGDSGGPL-QTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLR 332

  Fly   384 WI 385
            |:
  Fly   333 WL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855 2/3 (67%)
Tryp_SPc 136..385 CDD:214473 91/261 (35%)
Tryp_SPc 137..388 CDD:238113 91/262 (35%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 91/260 (35%)
Tryp_SPc 101..334 CDD:238113 90/260 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457376
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.