DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG8172

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:322 Identity:112/322 - (34%)
Similarity:167/322 - (51%) Gaps:55/322 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 TSAAPPPTTTSSSSRG-------------------QDGQAGLGNLLPSP-PKCGP-HSFSNKVYN 139
            ::.||||.....:::.                   ..|..|..:....| |.||. ::.||::..
  Fly   254 SAGAPPPHEPLPNAQAFAVGNVLDLNAGEAADEYQSGGSGGYHDASYRPVPGCGEVYTRSNRIVG 318

  Fly   140 GNDTAIDEFNW-MALLEYVDNRG--RRELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRLG 201
            |:.|......| :||::    .|  .|:|||||:||:||:|:||||||.....:.:    .:|||
  Fly   319 GHSTGFGSHPWQVALIK----SGFLTRKLSCGGALISNRWVITAAHCVASTPNSNM----KIRLG 375

  Fly   202 EYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVVLNEYIQPVCLP 266
            |:|.....:.::.      .:.|||:..|||.|:||  :.::|:||:||||.||..::|.|||||
  Fly   376 EWDVRGQEERLNH------EEYGIERKEVHPHYNPA--DFVNDVALIRLDRNVVYKQHIIPVCLP 432

  Fly   267 LVSTRMAINTGELLVVSGWGRTTTARKS--TIKQRLDLPVNDHDYCARKF--ATRNIHLISSQLC 327
            ..:|::   ||::..|:|||||...:.:  ::.|.:|:.|..:|.|.|.|  |.|...:....||
  Fly   433 PSTTKL---TGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVFLC 494

  Fly   328 VGGEFY----RDSCDGDSGGPLMRRGFDQAWYQEGVVSFGNRCGLEGWPGVYTRVADYMDWI 385
            .|   |    ||||.|||||||... .|......|:||:|..||.|..|||||.:..::.||
  Fly   495 AG---YKDGGRDSCQGDSGGPLTLT-MDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWI 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 98/259 (38%)
Tryp_SPc 137..388 CDD:238113 100/260 (38%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 98/259 (38%)
Tryp_SPc 316..555 CDD:238113 100/260 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.