DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and flz

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:421 Identity:118/421 - (28%)
Similarity:182/421 - (43%) Gaps:91/421 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KSTRKVVGIFLATCLLPFTVLQNVAAQ--GSCRNPNQKQGQCLSIYDCQSLLSVIQQSYVS---P 61
            |:..|.......|...|.|....|||:  .:.|.|..|:       ..:.:.|.::.:.||   |
  Fly  1320 KAPNKKTSAVSTTTRKPATRRTTVAAKVTTTTRRPATKK-------PTRRVSSTVKTTTVSSARP 1377

  Fly    62 EDRTFLRNSQCLDGVGRQPYVCCTSDRSFGSQEATSAAPPPT-------TTSSSSRGQDGQA--G 117
            .|                       |.....::.....|.|:       .|.||..|.:|:.  .
  Fly  1378 AD-----------------------DEIVDEEDEEDVNPNPSDNEIDQGATLSSYGGANGRKIHS 1419

  Fly   118 LGNLLPSP--------PKCG--PHSFSNKVYNGNDTAIDEFNWMALLE-------YVDNRGRREL 165
            ....||:|        .:||  ||..|.::..|..:....:.|..|:.       :..|:     
  Fly  1420 TSRTLPTPNLAFHSPSTECGVRPHVKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNK----- 1479

  Fly   166 SCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATV 230
             |||.||.:|||:|||||..|.:.:    |..| :||:|.|.|::      ::..:...:::..|
  Fly  1480 -CGGVLITSRYVITAAHCQPGFLAS----LVAV-MGEFDISGDLE------SKRSVTKNVKRVIV 1532

  Fly   231 HPQYDPANKNRIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTT-TARKS 294
            |.|||||...  :|:|||.||.||..:.:|.|:|:|   ..:|..||.:..|:||||.. .....
  Fly  1533 HRQYDPATFE--NDLALLELDSPVQFDTHIVPICMP---NDVADFTGRMATVTGWGRLKYGGGVP 1592

  Fly   295 TIKQRLDLPVNDHDYCARKFAT--RNIHLISSQLCVG---GEFYRDSCDGDSGGPLMRRGFDQAW 354
            ::.|.:.:|:.::..|...|.|  .|..:::|.||.|   |:  :|||:|||||||:.:..|..:
  Fly  1593 SVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAGYANGQ--KDSCEGDSGGPLVLQRPDGRY 1655

  Fly   355 YQEGVVSFGNRCGLEGWPGVYTRVADYMDWI 385
            ...|.||.|.:|.....||||.|...|..|:
  Fly  1656 ELAGTVSHGIKCAAPYLPGVYMRTTFYKPWL 1686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855 8/55 (15%)
Tryp_SPc 136..385 CDD:214473 85/261 (33%)
Tryp_SPc 137..388 CDD:238113 86/262 (33%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 86/262 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.