DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG4793

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:287 Identity:87/287 - (30%)
Similarity:130/287 - (45%) Gaps:46/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 PSPPKCGPH------SFSNKVYNGNDTA-IDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTA 180
            |.|.:|| |      .|:  :.|..|.| ..|..||..|  :|:|.|..|. |||||....|||:
  Fly    81 PLPTECG-HVNRIGVGFT--ITNARDIAQKGELPWMVAL--LDSRSRLPLG-GGSLITRDVVLTS 139

  Fly   181 AHCVIGAVETEVGHLTTVRLGEYDTSKDVD--CIDDICNQPILQ---LGIEQATVHPQYDPANKN 240
            :...:...|..:    .||.||:|.....:  ..:|:..:.|::   |.:|             |
  Fly   140 STKTLEVPEKYL----IVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVE-------------N 187

  Fly   241 RIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTARKS--TIKQRLDLP 303
            ..::.|||.|.||:.|:.:|..:|||..:.....|.   .:|||||:.|....|  .|.::::||
  Fly   188 GANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNR---CIVSGWGKKTALDNSYMNILKKIELP 249

  Fly   304 VNDHDYCARKFA---TRNIHLISSQLCVGGEFYRDSCDGDSGGPLM--RRGFDQAWYQEGVVSFG 363
            :.|...|..|..   .::..|.:|.:|.|||..:|:|.||.|.||.  .:.....:...|:|:||
  Fly   250 LVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFG 314

  Fly   364 NRCGLEGWPGVYTRVADYMDWIVETIR 390
            ..|| ...|..||.|:....||...|:
  Fly   315 FGCG-GPLPAAYTDVSQIRSWIDNCIQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 78/261 (30%)
Tryp_SPc 137..388 CDD:238113 80/263 (30%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 78/255 (31%)
Tryp_SPc 105..335 CDD:214473 76/253 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.