DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG18478

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:298 Identity:84/298 - (28%)
Similarity:125/298 - (41%) Gaps:76/298 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KCGPHSFSNKVYNGNDTAID-------------EFNW-MALLEYVDNRGRRELSCGGSLINNRYV 177
            |||         .||..|:.             ||.| :|::.      .|.|..|||||....|
  Fly    30 KCG---------YGNPDAVKVQFNVTEGQAKPAEFPWTIAVIH------NRSLVGGGSLITPDIV 79

  Fly   178 LTAAHCVIGAVETEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNR- 241
            |||||.:......::    .|..||::....::      ..|..:..:.:..:|..:   |..| 
  Fly    80 LTAAHRIFNKDVEDI----VVSAGEWEYGSALE------KYPFEEAFVLKMVIHKSF---NYQRG 131

  Fly   242 IHDIALLRLDRPVVLNEYIQPVCLP-----LVSTRMAINTGELLVVSGWGR--TTTARKSTIKQR 299
            .:::|||.|||...|...|..:|||     |.|||        .:|:|||:  .:......:.::
  Fly   132 ANNLALLFLDREFPLTYKINTICLPTQKRSLSSTR--------CIVAGWGKYQFSDTHYGGVLKK 188

  Fly   300 LDLPVNDHDYC---ARKFATR---NIHLISSQLCVGGEFYRDSCDGDSGGPLM------RRGFDQ 352
            :|||:.....|   .||  ||   |..|....:|.|||...|:|.||.||.|.      .:.|:|
  Fly   189 IDLPIVPRHICQDQLRK--TRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQ 251

  Fly   353 AWYQEGVVSFGNRCGLEGWPGVYTRVADYMDWIVETIR 390
            .    |:|::|..|..:..|..||.|.::..|||:.|:
  Fly   252 I----GIVNWGVGCKEKNVPATYTDVFEFKPWIVQQIK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 77/282 (27%)
Tryp_SPc 137..388 CDD:238113 80/284 (28%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 77/265 (29%)
Tryp_SPc 50..280 CDD:214473 74/262 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.