DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:302 Identity:102/302 - (33%)
Similarity:158/302 - (52%) Gaps:38/302 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 PPTTTSSSSRGQDGQAGLGNLLPSPPKCGPHS----FSNKVYNGNDTAIDEFNWMALLEYVDNRG 161
            |.|||:::.|...|.:..|    .|.:||..:    ...::..|.:.:..||.|:|:|   ...|
  Fly   364 PVTTTTTTRRPVSGTSSEG----LPLQCGNKNPVTPDQERIVGGINASPHEFPWIAVL---FKSG 421

  Fly   162 RRELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRLGEYD--TSKDVDCIDDICNQPILQLG 224
            ::  .||||||.|.::|||||||......:|..| |..||:|:  |..:|..:.....:.:...|
  Fly   422 KQ--FCGGSLITNSHILTAAHCVARMTSWDVAAL-TAHLGDYNIGTDFEVQHVSRRIKRLVRHKG 483

  Fly   225 IEQATVHPQYDPANKNRIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAIN-TGELLVVSGWGR- 287
            .|.:|:|           :|:|:|.|..||.....|||:|||...::.:.: :|::..|:|||. 
  Fly   484 FEFSTLH-----------NDVAILTLSEPVPFTREIQPICLPTSPSQQSRSYSGQVATVAGWGSL 537

  Fly   288 TTTARKSTIKQRLDLPVNDHDYCARKF---ATRNIHLISSQLCVGGEFYRDSCDGDSGGPLMRRG 349
            .....:.:|.|::|:|:..:..||||:   |...|  |.|.:| .|:..:|||.||||||::.. 
  Fly   538 RENGPQPSILQKVDIPIWTNAECARKYGRAAPGGI--IESMIC-AGQAAKDSCSGDSGGPMVIN- 598

  Fly   350 FDQAWY-QEGVVSFGNRCGLEGWPGVYTRVADYMDWIVETIR 390
             |...| |.|:||:|..||...:|||||||...:.||.:.|:
  Fly   599 -DGGRYTQVGIVSWGIGCGKGQYPGVYTRVTSLLPWIYKNIK 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 89/256 (35%)
Tryp_SPc 137..388 CDD:238113 91/258 (35%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 89/256 (35%)
Tryp_SPc 400..637 CDD:238113 91/258 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.