DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG1304

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:285 Identity:87/285 - (30%)
Similarity:127/285 - (44%) Gaps:67/285 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LLPSPPKCGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVI 185
            ||..|....|.|.:.:|..|.|...::|.....|.   |.|..  |||||:::..|||||||||.
  Fly    16 LLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLR---NAGSH--SCGGSILSRNYVLTAAHCVT 75

  Fly   186 -----GAVETEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDI 245
                 |..........|:|.|..|.         .....::|  :.:..||.:|.    |.::|:
  Fly    76 NQDSNGNSVPIAAERFTIRAGSNDR---------FSGGVLVQ--VAEVIVHEEYG----NFLNDV 125

  Fly   246 ALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTARKSTIKQRLDLPVNDHDYC 310
            |||||:.|::|:..|||:.||...|...::    :::|||||        ||.:.|||    .|.
  Fly   126 ALLRLESPLILSASIQPIDLPTADTPADVD----VIISGWGR--------IKHQGDLP----RYL 174

  Fly   311 ARKFAT-RNIHL----------ISSQLCVGGEFYRDSCDGDSGGPLMRRGFDQAWYQEGVVSFG- 363
              ::.| ::|.|          :.|:||:..|....:|:||||||        |.|...||... 
  Fly   175 --QYNTLKSISLERCDELIGWGVQSELCLIHEADNGACNGDSGGP--------AVYNNQVVGVAG 229

  Fly   364 ---NRCGLEGWPGVYTRVADYMDWI 385
               :.|| ..:|..|.||..:.:||
  Fly   230 FVWSACG-TSYPDGYARVYYHNEWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 80/268 (30%)
Tryp_SPc 137..388 CDD:238113 82/269 (30%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 80/268 (30%)
Tryp_SPc 32..256 CDD:238113 82/269 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.