DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and Ser6

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:279 Identity:88/279 - (31%)
Similarity:125/279 - (44%) Gaps:63/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PPKCGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVE 189
            |.:..|...:.:|..|.|...::|.....|.   |.|..  |||||::...|:|||||||   ..
  Fly    20 PVQSAPGKLNGRVVGGEDAVKNQFPHQVSLR---NAGSH--SCGGSILTRTYILTAAHCV---SN 76

  Fly   190 TEVGHLT--------TVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIA 246
            .:|.|:.        |:|.|..|.         .....::|  :.:..||.:|.    |.::|:|
  Fly    77 EDVNHVITPIAAERFTIRAGSNDR---------FSGGVLVQ--VAEVIVHEEYG----NFLNDVA 126

  Fly   247 LLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTARKSTIKQRLDLPVNDHDYCA 311
            ||||:.|::|:..|||:.||.|.|...::    :|:|||||        ||.:.||| ....|..
  Fly   127 LLRLESPLILSASIQPIDLPTVDTPADVD----VVISGWGR--------IKHQGDLP-RYLQYNT 178

  Fly   312 RKFATRN--IHLI----SSQLCVGGEFYRDSCDGDSGGPLMRRGFDQAWYQE---GVVSF-GNRC 366
            .|..||.  ..||    ..:||:..:....:|:||||||        |.|..   ||..| .:.|
  Fly   179 LKSITRQQCEELIDFGFEGELCLLHQVDNGACNGDSGGP--------AVYNNQLVGVAGFVVDGC 235

  Fly   367 GLEGWPGVYTRVADYMDWI 385
            | ..:|..|.||..:.|||
  Fly   236 G-STYPDGYARVFYFKDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 84/266 (32%)
Tryp_SPc 137..388 CDD:238113 86/267 (32%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 84/266 (32%)
Tryp_SPc 32..256 CDD:238113 86/267 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.