DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG14227

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:298 Identity:88/298 - (29%)
Similarity:136/298 - (45%) Gaps:56/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 QDGQAGL-----GNLLPSPPKCGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSL 171
            ::|.|.|     |..||:..|.   ::.|  |..:.|.|....|:..: .|:.:.:    |.|||
  Fly    20 REGSAFLLDAECGRSLPTNAKL---TWWN--YFDSSTDIQANPWIVSV-IVNGKAK----CSGSL 74

  Fly   172 INNRYVLTAAHCVIGAVETEVGHLTTVRLGEYDT-SKDVDCIDDICNQPILQLGIEQATVHPQYD 235
            ||:|:||||||||.       .....|.||::|. :...:|...........:.|::..||..:.
  Fly    75 INHRFVLTAAHCVF-------REAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFG 132

  Fly   236 PANKNRIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTAR-------- 292
            .....: :||.|||:...|..:::::|:||.:.....||:..:|.|   ||  |||.        
  Fly   133 KIQAQQ-YDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQLTV---WG--TTAEDFRSIPRV 191

  Fly   293 -KSTIKQRLDLPVNDHDYCARKFATRNIHLISSQLCVGGEFYRDSCDGDSGGPLMRR---GFDQA 353
             |.::..|:     |.:.|..||..:   :..||:||..| ...:|.||||||...:   |....
  Fly   192 LKHSVGDRI-----DRELCTLKFQQQ---VDESQICVHTE-TSHACKGDSGGPFSAKILYGGTYR 247

  Fly   354 WYQEGVVSFG-NRC-GLEGWPGVYTRVADYMDWIVETI 389
            .:|.|::.|| :.| ||    .|.|.|..|||||.:.:
  Fly   248 TFQFGIIIFGLSSCAGL----SVCTNVTFYMDWIWDAL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 78/263 (30%)
Tryp_SPc 137..388 CDD:238113 80/265 (30%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 75/250 (30%)
Tryp_SPc 57..277 CDD:238113 75/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.