DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG33160

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:268 Identity:78/268 - (29%)
Similarity:118/268 - (44%) Gaps:61/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCV----------IGAVET 190
            ::..|:.::|.|..::     |......|| |||||:..|:|:||||||          .|....
  Fly    33 RIIGGHVSSIKEEKYL-----VQVTTSEEL-CGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASN 91

  Fly   191 EVGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVV 255
            :.|....:|..:|                        ..:.|.::....|.  |:|.|||:..::
  Fly    92 QAGPYAVIRTVDY------------------------IAIRPDFNRKTLNM--DVAALRLNSDMI 130

  Fly   256 LNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTARKSTIKQ--RLDLPVNDHDYCARKFATRN 318
             ...|:.:  ||.:  .::....|:.|||||..|.....|.::  .:.:|:.....|...|  |.
  Fly   131 -GANIETI--PLAA--QSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAF--RG 188

  Fly   319 IHLIS-SQLCVGGEFYRDSCDGDSGGPLMRRGFDQAWYQEGVVSFGNRCGLEGWPGVYTRVADYM 382
            ||.|: |.:|....:.:|||||||||||:.||     ...|:||||..|. ...||:||.|.:..
  Fly   189 IHRITRSMVCAARLYKKDSCDGDSGGPLVYRG-----QLAGIVSFGYGCA-SALPGIYTSVPEIR 247

  Fly   383 DW---IVE 387
            ||   :||
  Fly   248 DWFQRVVE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 76/264 (29%)
Tryp_SPc 137..388 CDD:238113 78/267 (29%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 74/260 (28%)
Tryp_SPc 34..253 CDD:238113 76/263 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.