DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and Tpsg1

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:281 Identity:93/281 - (33%)
Similarity:128/281 - (45%) Gaps:50/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LLPSPPKCGPHSFS---NKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAH 182
            ||.:.|.||....|   :::..|:......:.|.|.|     |.::...|||||::..:||||||
  Rat    11 LLLAVPGCGQPQVSHAGSRIVGGHAAQAGAWPWQASL-----RLQKVHVCGGSLLSPEWVLTAAH 70

  Fly   183 CVIGAV-----ETEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRI 242
            |..|:|     |..:|.||......:.|.|.:                    :.....|......
  Rat    71 CFSGSVNSSDYEVHLGELTITLSPHFSTVKQI--------------------IMYSSAPGPPGSS 115

  Fly   243 HDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTARKSTIK-----QRLDL 302
            .||||::|..||.|:..:||||||..|.  ..:.|....|:|||.|...  ..:|     |...:
  Rat   116 GDIALVQLATPVALSSQVQPVCLPEASA--DFHPGMQCWVTGWGYTQEG--EPLKPPYNLQEAKV 176

  Fly   303 PVNDHDYCARKFATRNIHLI-SSQLCVGGEFYRDSCDGDSGGPLMRR--GFDQAWYQEGVVSFGN 364
            .|.|.:.|::.:::.|..|| |..||..|.  .|:|..||||||:.|  |.   |.|.||||:|.
  Rat   177 SVVDVETCSQAYSSSNGSLIQSDMLCAWGP--GDACQDDSGGPLVCRVAGI---WQQAGVVSWGE 236

  Fly   365 RCGLEGWPGVYTRVADYMDWI 385
            .||....||||.||..|::||
  Rat   237 GCGRPDRPGVYARVTAYVNWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 85/261 (33%)
Tryp_SPc 137..388 CDD:238113 87/262 (33%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 85/261 (33%)
Tryp_SPc 30..260 CDD:238113 87/262 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.