DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and F10

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:412 Identity:109/412 - (26%)
Similarity:169/412 - (41%) Gaps:93/412 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NPNQKQGQC---LSIYDCQSLLSVIQQSYVSPEDRTFLRNSQCLDGVG-------RQPYVCCTSD 87
            :|.|.||:|   |..|.|     ...:.:.......|:|....||...       .|..|.|:..
  Rat    93 SPCQNQGECRDGLGSYTC-----TCTEGFEGKNCELFVRKLCSLDNGDCDQFCREEQNSVVCSCA 152

  Fly    88 RSF----GSQEATSAAPPPTTTSSSSRGQDGQA-GLGNLLPSP-----------PKCGPHSFSN- 135
            :.:    ..:...|.||.|...::..|.:...| ...|..|.|           |...|....| 
  Rat   153 KGYFLGNDGKSCLSTAPFPCGKTNKGRAKRSVALNTSNSEPDPEDLMPDADILYPTESPSELLNL 217

  Fly   136 -------------KVYNGNDTAIDEFNWMALL---EYVDNRGRRELSCGGSLINNRYVLTAAHCV 184
                         ::..|.:....|..|.|||   |..|.      .|||:::|..|:||||||:
  Rat   218 NKTEPEANSDDVIRIVGGQECKRGECPWQALLFSDEETDG------FCGGTILNEFYILTAAHCL 276

  Fly   185 IGAVETEVGHLTTVRLGEYDTSKD-----VDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHD 244
            ..|...:      ||:|:.:|.::     |..:|.|......|        ...||       .|
  Rat   277 HQAKRFK------VRVGDLNTEQEDGGEMVHEVDMIIKHNKFQ--------RDTYD-------FD 320

  Fly   245 IALLRLDRPVVLNEYIQPVCLP----LVSTRMAINTGELLVVSGWGRT-TTARKSTIKQRLDLPV 304
            ||:|||..|:...|.:.|.|||    ..:|.|...||   :|||:||| ...|:|.:.:.:::|.
  Rat   321 IAMLRLKTPITFRENVAPACLPQKDWAEATLMTQKTG---IVSGFGRTHEKGRQSKVLKMMEVPY 382

  Fly   305 NDHDYCARKFATRNIHLISSQLCVGGEF-YRDSCDGDSGGPLMRRGFDQAWYQEGVVSFGNRCGL 368
            .|.:.|  :.:| :..:..:..|.|.:. ..|:|.||||||.:.| |...::..|:||:|..|..
  Rat   383 VDRNTC--RLST-SFSITQNMFCAGYDAKQEDACQGDSGGPHVTR-FKDTYFVTGIVSWGEGCAR 443

  Fly   369 EGWPGVYTRVADYMDWIVETIR 390
            :|..|:||:|..::.||..:::
  Rat   444 KGKYGIYTKVTAFLKWIDRSMK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855 14/60 (23%)
Tryp_SPc 136..385 CDD:214473 80/262 (31%)
Tryp_SPc 137..388 CDD:238113 82/264 (31%)
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011 8/33 (24%)
FXa_inhibition 129..164 CDD:405372 5/34 (15%)
Tryp_SPc 232..462 CDD:238113 82/263 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.