DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and TPSG1

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:321 Identity:93/321 - (28%)
Similarity:132/321 - (41%) Gaps:72/321 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 CTSDRSFGSQEATSAAPPPTTTSSSSRGQDGQAGLGNLLPSPPKCGPHSFSN---KVYNGNDTAI 145
            |...|..|.........||.|.||...|                ||....|:   ::..|:....
Human    23 CGQGRLHGGSAVGFLGSPPGTPSSFDLG----------------CGRPQVSDAGGRIVGGHAAPA 71

  Fly   146 DEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRLGEYDTSKDVD 210
            ..:.|.|.|     |.||...|||||::.::|||||||..|::.:          .:|.      
Human    72 GAWPWQASL-----RLRRVHVCGGSLLSPQWVLTAAHCFSGSLNS----------SDYQ------ 115

  Fly   211 CIDDICNQPILQLGIEQATVHPQYDPANKNRIH-----------DIALLRLDRPVVLNEYIQPVC 264
                      :.||..:.|:.|.:....:..:|           ||||:.|..||.|:..|.|||
Human   116 ----------VHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVC 170

  Fly   265 LPLVSTRMAINTGELLVVSGWGRTTTAR----KSTIKQRLDLPVNDHDYCARKFATRNIHLIS-S 324
            ||..|....  .|....|:|||.|....    ..:::: :.:.|.|.:.|.|.:......::. .
Human   171 LPEASDDFC--PGIRCWVTGWGYTREGEPLPPPYSLRE-VKVSVVDTETCRRDYPGPGGSILQPD 232

  Fly   325 QLCVGGEFYRDSCDGDSGGPLMRRGFDQAWYQEGVVSFGNRCGLEGWPGVYTRVADYMDWI 385
            .||..|.  .|:|..||||||:.: .:.||.|.|.||:|..||....|||||||..|::||
Human   233 MLCARGP--GDACQDDSGGPLVCQ-VNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855 93/321 (29%)
Tryp_SPc 136..385 CDD:214473 79/264 (30%)
Tryp_SPc 137..388 CDD:238113 81/265 (31%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 79/264 (30%)
Tryp_SPc 63..293 CDD:238113 81/265 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152782
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.