DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG30287

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:258 Identity:92/258 - (35%)
Similarity:128/258 - (49%) Gaps:29/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVETEVGHLTTVRL 200
            :|.||....:....||.:   :..||.  :.||||||..|||||||||     ::|.....||||
  Fly    41 RVINGKPADLFSNPWMVI---IIERGM--MKCGGSLITPRYVLTAAHC-----KSETKSQLTVRL 95

  Fly   201 GEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVVLNEYIQPVCL 265
            |:||.::.|||....|.....::.:.:..|...|....||   |||||||:..|...:.|:.:||
  Fly    96 GDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKN---DIALLRLETTVQYGDNIRSICL 157

  Fly   266 PLVSTRMAINTGELLV---VSGWGRTTTARKSTIKQRLDLPVNDHDYCARKFATRNIHLISSQLC 327
            .:.....:.|..:.||   .:|||||.:...|.:.|:..|..:...|||:.|..:   |..|.:|
  Fly   158 LMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHHLSYCAQVFGKQ---LDKSHIC 219

  Fly   328 VGGEFYRDSCDGDSGGPL---MRRGFDQAWYQEGVVSFGN-RC-GLEGWPGVYTRVADYMDWI 385
            |... ...:|.|||||||   :|.|.::.....||||:|. .| |    |.|||.|..:.:||
  Fly   220 VASS-TGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG----PTVYTNVIHFANWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 90/256 (35%)
Tryp_SPc 137..388 CDD:238113 92/257 (36%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 90/256 (35%)
Tryp_SPc 42..280 CDD:238113 92/257 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.