DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp7 and CG30088

DIOPT Version :9

Sequence 1:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:267 Identity:95/267 - (35%)
Similarity:145/267 - (54%) Gaps:32/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 PKCGPHSFSN---KVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGA 187
            |.||....||   ::..|.:..:....:||.|.|     ..|:.|||::|::||:||||||:...
  Fly    31 PSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYY-----SSEIHCGGTIISSRYILTAAHCMRPY 90

  Fly   188 VETEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDR 252
            ::        |||||:|.:::.||....|:.|..:..|..||.:.::|....|   |||||:|.|
  Fly    91 LK--------VRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRFLAN---DIALLKLSR 144

  Fly   253 PVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTARKSTIKQRLDLPVNDHDYCARKFATR 317
            .:..|.:|||:|| :::...|.|..|.... |||:|.|...:.:.|...|...|:.:|.   :..
  Fly   145 NIRFNVHIQPICL-ILNPAAAPNVHEFQAF-GWGQTETNHSANVLQTTVLTRYDNRHCR---SVL 204

  Fly   318 NIHLISSQLCVGGEFYRDSCDGDSGGPLMRR-GFDQAW--YQEGVVSFG-NRCGLEGWPGVYTRV 378
            ::.:..:|||||.: ..|:|.|||||||:.: .:|..|  .|.|:|||| ::|..   |||||.|
  Fly   205 SMPITINQLCVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQS---PGVYTYV 265

  Fly   379 ADYMDWI 385
            .:|:.||
  Fly   266 PNYIRWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 88/252 (35%)
Tryp_SPc 137..388 CDD:238113 90/253 (36%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 88/252 (35%)
Tryp_SPc 45..273 CDD:238113 90/253 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.